Kvantitativní proteomická analýza

Rozměr: px
Začít zobrazení ze stránky:

Download "Kvantitativní proteomická analýza"

Transkript

1 Kvantitativní proteomická analýza Martin Hubálek Kvantifikace proteinů Většinou pouze relativní srovnání odezvy mezi dvěma experimenty, případně mezi experimentem a standardem Množství proteinu bývá odvozeno z množství jednoho nebo více peptidů z proteinové sekvence Založené na porovnání výšky nebo plochy píku Peptidu(s) m/z (MS úroveň MS1) Fragmentu peptidu m/z (MS/MS úroveň MS2) Důležitý výběr peptidu Proteotypický peptid

2 Kvantifikace proteinů Bezznačková (Labelfree) MS1 MS2 Stabilní Izotopové značení ( stable isotope labelling) 2DE Cílená SRM Data Independent Analysis (DIA) SWATH Metabolické SILAC 14 N/ 15 N medium MS1 mtraq Nterm Dimethyl MS2 itraq TMT Chemické Cterm Esterifikace 16 O/ 18 O inkorporace Aminokyselina Lys (itraq) Cys (ICAT) Trp Proteotypický peptid Peptidy, které je možné zaznamenat pomocí LC MS Štěpitelné použitou proteázou (nejčastěji trypsin) Bez možných variabilních modifikaci (Met, Trp) Správná retence na C18 Ionizace v nanoesi Peptidy, které jsou specifické pro stanovovaný protein ve směsi s ostatními proteiny Prohledání sekvence proti všem dostupným proteinovým sekvencím

3 PEPTIDERANK Predikce proteotypických peptidů MKSINILSFLLLSSTLSLVAFARSFTSENPIVLPTTCHDDDNLVLPEVYDQDGNPLRIGERY IINNPLLGAGAVYLYNIGNLQCPNAVLQHMSIPQFLGEGTPVVFVRKSESDYGDVVRVMTVV YIKFFVKTTKLCVDQTVWKVNDEQLVVTGGKVGNENDIFKIMKTDLVTPGGSKYVYKLLHCP SHLGCKNIGGNFKNGYPRLVTVDDDKDFIPFVFIKA Bezznačkové metody

4 Kvantifikace proteinů Bezznačková (Labelfree) MS1 MS2 Stabilní Izotopové značení ( stable isotope labelling) 2DE Cílená SRM Data Independent Analysis (DIA) SWATH Metabolické SILAC 14 N/ 15 N medium MS1 mtraq Nterm Dimethyl MS2 itraq TMT Chemické Cterm Esterifikace 16 O/ 18 O inkorporace Aminokyselina Lys (itraq) Cys (ICAT) Trp Selected Reaction Monitoring (SRM)

5 Selected Reaction Monitoring (SRM) Cílený přístup Výběr prekursoru (Peptide m/z) Q1 Fragmentace v kolizní cele Q2 Sken fragmentu (Peptide fragment m/z) Q3 Quantitation MS APLDNDIGVSEATR (Beta-galaktosidáza) e4 % m/z MSMS 100 y1 y3 y5 y6 y7 y8 y9 y10 y11 y12 y13 R TA ES V G I D N D L P A b2 b4 b % Přechody: ID Q1 Q3 CE m/z APLDNDIGVSEATRy8 729,4 832,5 42 APLDNDIGVSEATRy12 729,4 1289,6 42 APLDNDIGVSEATRy11 729,4 1176,6 42

6 XIC of MRM (80 pairs): 729,4/1176,6 Da ID: APLDNDIGVSEATR from Sample... Max. 1,8e5 cps. 1,8e5 1,6e5 1,4e5 729,4 832,5 1,2e5 1,0e5 8,0e4 6,0e4 4,0e4 2,0e4 0, Time, min XIC of MRM (80 pairs): 729,4/832,5 Da ID: APLDNDIGVSEATR from Sample... Max. 1,4e5 cps. 1,4e5 1,2e5 1,0e5 8,0e4 6,0e4 4,0e4 2,0e4 729,4 1176,6 XIC of MRM (80 pairs): 729,4/1176,6 Da ID: APLDNDIGVSEATR from Sample... 1,8e5 1,6e5 1,4e5 1,2e5 1,0e5 8,0e4 Max. 1,8e5 cps. 0, Time, min XIC of MRM (80 pairs): 729,4/1289,6 Da ID: APLDNDIGVSEATR from Sample... 1,28e5 1,20e5 1,00e5 8,00e4 6,00e4 4,00e4 Max. 1,3e5 cps. 729,4 1289,6 6,0e4 4,0e4 2,0e4 0, Time, min 2,00e4 0, Time, min Skyline sw pro tvorbu SRM přechodů i vyhodnocení výsledků Selekce nábojového stavu Selekce přechodů Optimalizace kolizní energie Finální metoda

7 Scheduled MRM maximalizace cyklu monitoruje každý MRM přechod jen očekávaném elučním čase redukuje počet překrývajících se přechodů zvyšuje čas měření pro každý přechod zlepšuje analytickou přesnost lepší LLOQ Cycle Time mnoho MRM málo MRM Intensity (cps) MRM XIC Time (mins)

8 AQUA Absolutní kvantifikace Stabilně izotopicky značený peptid o stejné sekvenci jakou kvantifikuji Peak ratio Light x Heavy PeptideSequence ProteinName ReplicateName Absolute spike RT RatioToStandard AGPESDGQFQFTGIK sp Q9JJW3 USMG5_RAT _RHD50G50 50 fmol THSDQFLVSFK tr Q6PCU0 Q6PCU0_RAT _RHD50G50 50 fmol Absolutní koncetrace proteinu USMG5: 50 * 4,0401 = 202 fmol Q6PCU0: 50* 4,0608 = 203 fmol

9 Full Dynamic Range Proteome Analysis of S. cerevisiae by Targeted Proteomics Figure 1 Cellular Concentrations of the Set of Measured Proteins Protein abundances are derived from Ghaemmaghami et al. (2003). Proteins detected by SRM assays are sorted by abundance to show the even distribution across the whole range of concentration (blue circles). Proteins for which the absolute abundance was measured using isotopicallylabeled standards are indicated on top of the graph (open circles). SRM (MRM) peptidů Vysoce selektivní Široký dynamický rozsah

10 SWATH SWATHMS: Sequential Windowed data independent Acquisition of the Total Highresolution Mass Spectra Selekční okno prekurzoru kolem 25 mu (v SRM jednotka m/z) Fragmentacev kolizní cele MS/MS scan pro všechny prekurzory v cele fragmenty ze všech dohromady TripleTOF 5600 SWATHMS Adapted from Gillet et. al., Molecular & Cellular Proteomics, 2012

11 Příklad Affinity Purification coupled to Mass Spectrometry Cell culture Lysate Affinity purification Cloning Nterminally FLAG Ddi2 ptretight vector Hit verification Identification of hits Quantitative MS analysis Peptide preparation

12 Plot of Ttest tvalue versus pvalue. Red marks higlight proteins positively enriched in Ddi2 expressing cells Interakční proteiny Accession number Protein Name tvalue pvalue Fold Change sp P62987 RL40_HUMAN Ubiquitin60S ribosomal protein L E sp P54727 RD23B_HUMAN UV excision repair protein RAD23 homolog B E sp P11142 HSP7C_HUMAN Heat shock cognate 71 kda protein E sp P08107 HSP71_HUMAN Heat shock 70 kda protein 1A/1B E sp O95757 HS74L_HUMAN Heat shock 70 kda protein 4L E sp P34932 HSP74_HUMAN Heat shock 70 kda protein E sp Q15424 SAFB1_HUMAN Scaffold attachment factor B E sp P38646 GRP75_HUMAN Stress70 protein, mitochondrial E sp P11021 GRP78_HUMAN 78 kda glucoseregulated protein E

13 a) b) Fig 5.: example of manual curation of statistical result. Proteins a) UV excision repair protein RAD23 homolog B, and protein b) was assigned significant by Ttest analysis. The manual curation of protein b) disproved the result. Stabilní izotopové značení Stabilní izotopy Těžké (heavy): 13 C, 15 N, 18 O, 2 H Lehké (light): 12 C, 14 N, 16 O, 1 H Zavedení jednoho atomu Trypsinové štěpení v H 2 18 O 15 N značené v buněčné kultuře Zavedení skupiny s několika těžkými izotopy Stable isotope labelling of amino acids in cell culture (SILAC) Isobaric tag for relative and absolute quantitation (itraq) Dimethyl labelling předpoklad Shodné chování v průběhu chromatografie a ionizace odpovídající H/L formy peptidu eluují ve stejný čas obě formy mají stejnou pravděpodobnost ionizace na pozadí danné matrice

14 Kvantifikace proteinů Bezznačková (Labelfree) MS1 MS2 Stabilní Izotopové značení ( stable isotope labelling) 2DE Cílená SRM Data Independent Analysis (DIA) SWATH Metabolické SILAC 14 N/ 15 N medium MS1 mtraq Nterm Dimethyl MS2 itraq TMT Chemické Cterm Esterifikace 16 O/ 18 O inkorporace Aminokyselina Lys (itraq) Cys (ICAT) Trp DOI: /B618553N

15 Stabilní izotopové značení Metabolické Eg. SILAC Chemické Eg. Dimethyl labeling Značení stabilními izotopy - SILAC o Stable Isotope Labeling with amino ACids in cell culture (SILAC) o Metoda relativní kvantifikace proteinů ve dvou paralelně kultivovaných buněčných kulturách v médiu s lehkými nebo těžkými AK. o V mediu s těžkými AK se používá např.: Arg, Lys 13 C, 15 N o Kvantifikace MS1, ověření identity v MS2 o Nutné dosáhnout vysoké úrovně inkorporace těžkých AK do buněk o Minimálně 5 buněčných cyklů MS spektrum 2x nabitých iontů při SILAC experimentu 37

16 SILAC Inkorporace Inkorporace těžkých AK ( 13 C 15 N Arg, Lys) do buněčné kultury Protein selection Peptide selection H/L ratio = 35 i.e. incorporation level 97 % SILAC výsledek

17 SILAC Vzorky jsou smíseny na počátku experimentu Vhodné pro složité postupy přípravy vzorku Je možné použít shotgun i cílený přístup Auxotrofie pro Lys, Arg Snadné pouze v buněčných kulturách Metabolická konverze Arg na Pro Limitovaná multiplicita drahé Kvantifikace proteinů Bezznačková (Labelfree) MS1 MS2 Stabilní Izotopové značení ( stable isotope labelling) 2DE Cílená SRM Data Independent Analysis (DIA) SWATH Metabolické SILAC 14 N/ 15 N medium Nterm MS1 mtraq Dimethyl MS2 itraq TMT Chemické Cterm Esterifikace 16 O/ 18 O inkorporace Aminokyselina Lys (itraq) Cys (ICAT) Trp

18

19 Reakce Ntermini a εamino skupiny Lys s formaldehydem následovanou redukcí kyanoborohydridem sodným Dimethyl Labeling Boersema, P. J., et al. Triplex protein quantification based on stable isotope labeling by peptide dimethylation applied to cell and tissue lysates. Proteomics. 8, 2008, pp Dimethyl labelling Levné a snadno sehnatelné reagencie Reakce rychlá V roztoku po štěpení ostatní primarní aminy mohou reagovat s formaldehydem vynechat Tris, Am. Bic, použij TEAB Všechny kroky před smísením kriticky důležité pro kvantifikaci optimalizace

20 Izobarická značka pro rel. a abs. kvantifikaci itraq Isobaric Tag for Relative and Absolute Quantitation (itraq) Současná (relativní) kvantifikace až 4 vzorků. Sada 4 izobarických činidel, která se váží na aminoskupinu peptidů (proteinů). V MS mají stejný poměr m/z, v MS/MS poskytují 4 různé ionty. MS MS/MS Isobarická značka 145 Da itraq značky Relativní kvantifikace podle intenzit iontů m/z 114, 115, 116, 117 Možný i oktaplex 39 itraq Poměry jsou odečteny po peptidové fragmentaci MS/MS (MS2): Reporterové ionty a jejich poměry určují rozdíly v kvantitě

21 itraq Levnější než SILAC Reakce rychlá V roztoku po štěpení Stejné chování peptidu v průběhu analýzy až na rozdíl v MSMS spektru ostatní primarní aminy mohou reagovat s formaldehydem vynechat Tris, Am. Bic, použij TEAB Všechny kroky před smísením kriticky důležité pro kvantifikaci optimalizace Skutečné rozdíly v kvantitě jsou větší než naměřené Kvantifikace proteinů Bezznačková (Labelfree) MS1 MS2 Stabilní Izotopové značení ( stable isotope labelling) 2DE Cílená SRM Data Independent Analysis (DIA) SWATH Metabolické SILAC 14 N/ 15 N medium Nterm MS1 mtraq Dimethyl MS2 itraq TMT Chemické Cterm Esterifikace 16 O/ 18 O inkorporace Aminokyselina Lys (itraq) Cys (ICAT) Trp

22 Dvoudimensionální elektroforéza 2DE princip metody První dimense pi 3 pi 10 _ Polyakrylamidový gel Druhá dimense 2DE relativní kvantifikace

Gel-based a Gel-free kvantifikace v proteomice

Gel-based a Gel-free kvantifikace v proteomice Gel-based a Gel-free kvantifikace v proteomice Juraj Lenčo Ústav molekulární patologie Fakulta vojenského zdravotnictví U Hradec Králové Funkce proteinů Proteomika Lokalizace proteinů Proteinové interakce

Více

MENÍ A INTERPRETACE SPEKTER BIOMOLEKUL. Miloslav Šanda

MENÍ A INTERPRETACE SPEKTER BIOMOLEKUL. Miloslav Šanda MENÍ A INTERPRETACE SPEKTER BIOMOLEKUL Miloslav Šanda Ionizaní techniky využívané k analýze biomolekul (biopolymer) MALDI : proteiny, peptidy, oligonukleotidy, sacharidy ESI : proteiny, peptidy, oligonukleotidy,

Více

Základy hmotnostní spektrometrie

Základy hmotnostní spektrometrie Základy hmotnostní spektrometrie Lenka Hernychová e-mail: hernychova@pmfhk.cz Ústav molekulární patologie, Fakulta vojenského zdravotnictví, Universita obrany Hradec Králové Historie Koichi Tanaka vyvinul

Více

Kapalinová chromatografie s tandemovou hmotnostní detekcí Teoretický úvod

Kapalinová chromatografie s tandemovou hmotnostní detekcí Teoretický úvod Kapalinová chromatografie s tandemovou hmotnostní detekcí Teoretický úvod Vysokoúčinná kapalinová chromatografie s tandemovou hmotnostní detekcí se řadí mezi nejcitlivější separační metody určené ke kvantitativní

Více

Stanovení koncentrace (kvantifikace) proteinů

Stanovení koncentrace (kvantifikace) proteinů Stanovení koncentrace (kvantifikace) proteinů Bioanalytické metody Prof. RNDr. Pavel Peč, CSc. Úvod Kritéria výběru metod stanovení koncentrace proteinů jsou založena na možnostech pro vlastní analýzu,

Více

Zpráva ze zahraniční odborné stáže

Zpráva ze zahraniční odborné stáže Zpráva ze zahraniční odborné stáže Zahraniční odborná stáž byla realizována v rámci projektu ROZVOJ A POSÍLENÍ SPOLUPRÁCE MEZI AKADEMICKÝMI A SOUKROMÝMI SUBJEKTY SE ZAMĚŘENÍM NA CHEMICKÝ A FARMACEUTICKÝ

Více

Identifikace proteinu (z gelu nebo z roztoku)

Identifikace proteinu (z gelu nebo z roztoku) LC/MS a CE/MS v proteomické analýze OBSAH Příklad jednoduché analýzy Separční techniky MS techniky Identifikace proteinů Určení molekulové hmotnosti Analytická výzva Mgr. Martin Hubálek, Ph.D. Ústav organické

Více

Typizace amyloidóz pomocí laserové mikrodisekce a hmotnostní spektrometrie

Typizace amyloidóz pomocí laserové mikrodisekce a hmotnostní spektrometrie Typizace amyloidóz pomocí laserové mikrodisekce a hmotnostní spektrometrie Dušan Holub Laboratoř experimentální medicíny, Ústav molekulární a translační medicíny Lékařské fakulty Univerzity Palackého v

Více

HMOTNOSTNÍ SPEKTROMETRIE - kvalitativní i kvantitativní detekce v GC a LC - pyrolýzní hmotnostní spektrometrie - analýza polutantů v životním

HMOTNOSTNÍ SPEKTROMETRIE - kvalitativní i kvantitativní detekce v GC a LC - pyrolýzní hmotnostní spektrometrie - analýza polutantů v životním HMOTNOSTNÍ SPEKTROMETRIE - kvalitativní i kvantitativní detekce v GC a LC - pyrolýzní hmotnostní spektrometrie - analýza polutantů v životním prostředí - farmakokinetické studie - kvantifikace proteinů

Více

volba separace pro následnou MS kvantifikaci proteinů Jan Havliš Masarykova univerzita Přírodovědecká fakulta, Brno Ústav experimentální biologie : Oddělení funkční genomiky a proteomiky :: Centrální laboratoř

Více

Extrakce. Dělení podle způsobů provedení -Jednostupňová extrakce - mnohastupňuvá extrakce - kontinuální extrakce

Extrakce. Dělení podle způsobů provedení -Jednostupňová extrakce - mnohastupňuvá extrakce - kontinuální extrakce Extrakce Slouží k izolaci, oddělení analytu nebo skupin látek s podobnými vlastnostmi od matrice a ostatních látek, které nejsou předmětem analýzy (balasty). Extrakce je založena na ustavení rovnováhy

Více

Příprava vzorků pro proteomickou analýzu

Příprava vzorků pro proteomickou analýzu Příprava vzorků pro proteomickou analýzu 1) Úvod Proteomické analýzy mohou být naprosto odlišné cíle... Detekce změn v mozkové kůře při Alzheimerově chorobě Identifikace plazmatických markerů karcinomu

Více

Diagnostika bronchiálního. ho astmatu HPLC/MS analýzou. Kamila Syslová Ústav organické technologie

Diagnostika bronchiálního. ho astmatu HPLC/MS analýzou. Kamila Syslová Ústav organické technologie Diagnostika bronchiálního ho astmatu HPLC/MS analýzou Kamila Syslová Ústav organické technologie Bronchiální astma Civilizační onemocnění rostoucí počet případů snižující se věková hranice prvních projevů

Více

Strategie peptidp. sekvenování. Derivatizace: Chemically Assisted Fragmentation CAF. 2 O značení. Esterifikace (EtOH: 28 Da / COOH skupinu)

Strategie peptidp. sekvenování. Derivatizace: Chemically Assisted Fragmentation CAF. 2 O značení. Esterifikace (EtOH: 28 Da / COOH skupinu) Hmotnostní spektrometrie v analýze biomolekul Kontrola kvality/čistoty Určení MW Identifikace Sekvenování Charakterizace modifikací Studium nekovalentních komplexů Analýza směsí Kvantifikace Studium 3D

Více

STANOVENÍ AMINOKYSELINOVÉHO SLOŽENÍ BÍLKOVIN. Postup stanovení aminokyselinového složení

STANOVENÍ AMINOKYSELINOVÉHO SLOŽENÍ BÍLKOVIN. Postup stanovení aminokyselinového složení STANVENÍ AMINKYSELINVÉH SLŽENÍ BÍLKVIN Důvody pro stanovení AK složení určení nutriční hodnoty potraviny, suroviny (esenciální vs. neesenciální AK) charakterizace určité bílkovinné frakce nebo konkrétní

Více

Metody práce s proteinovými komplexy

Metody práce s proteinovými komplexy Metody práce s proteinovými komplexy Zora Nováková, Zdeněk Hodný Proteinové komplexy tvořeny dvěma a více proteiny spojenými nekovalentními vazbami Van der Waalsovy síly vodíkové můstky hydrofobní interakce

Více

CRH/NPU I - Systém pro ultraúčinnou kapalinovou chromatografii (UHPLC) ve spojení s tandemovým hmotnostním spektrometrem (MS/MS)

CRH/NPU I - Systém pro ultraúčinnou kapalinovou chromatografii (UHPLC) ve spojení s tandemovým hmotnostním spektrometrem (MS/MS) ODŮVODNĚNÍ VEŘEJNÉ ZAKÁZKY v souladu s 156 zákona č. 137/2006, Sb., o veřejných zakázkách, ve znění pozdějších předpisů Nadlimitní veřejná zakázka na dodávky zadávaná v otevřeném řízení v souladu s ust.

Více

Evropský sociální fond Praha & EU: Investujeme do vaší budoucnosti URČOVÁNÍ PRIMÁRNÍ STRUKTURY BÍLKOVIN

Evropský sociální fond Praha & EU: Investujeme do vaší budoucnosti URČOVÁNÍ PRIMÁRNÍ STRUKTURY BÍLKOVIN Evropský sociální fond Praha & EU: Investujeme do vaší budoucnosti URČOVÁNÍ PRIMÁRNÍ STRUKTURY BÍLKOVIN Primární struktura primární struktura bílkoviny je dána pořadím AK jejích polypeptidových řetězců

Více

METODY STUDIA PROTEINŮ

METODY STUDIA PROTEINŮ METODY STUDIA PROTEINŮ Mgr. Vlasta Němcová vlasta.furstova@tiscali.cz OBSAH PŘEDNÁŠKY 1) Stanovení koncentrace proteinu 2) Stanovení AMK sekvence proteinu Hmotnostní spektrometrie Edmanovo odbourávání

Více

ANORGANICKÁ HMOTNOSTNÍ SPEKTROMETRIE

ANORGANICKÁ HMOTNOSTNÍ SPEKTROMETRIE ANORGANICKÁ HMOTNOSTNÍ SPEKTROMETRIE (c) David MILDE 2003-2010 Metody anorganické MS ICP-MS hmotnostní spektrometrie s indukčně vázaným plazmatem, GD-MS spojení doutnavého výboje s MS, SIMS hmotnostní

Více

Moderní nástroje v analýze biomolekul

Moderní nástroje v analýze biomolekul Moderní nástroje v analýze biomolekul Definice Hmotnostní spektrometrie (zkratka MS z anglického Mass spectrometry) je fyzikálně chemická metoda. Metoda umožňující určit molekulovou hmotnost chemických

Více

Metabolismus bílkovin. Václav Pelouch

Metabolismus bílkovin. Václav Pelouch ZÁKLADY OBECNÉ A KLINICKÉ BIOCHEMIE 2004 Metabolismus bílkovin Václav Pelouch kapitola ve skriptech - 3.2 Výživa Vyvážená strava člověka musí obsahovat: cukry (50 55 %) tuky (30 %) bílkoviny (15 20 %)

Více

Genomické databáze. Shlukování proteinových sekvencí. Ivana Rudolfová. školitel: doc. Ing. Jaroslav Zendulka, CSc.

Genomické databáze. Shlukování proteinových sekvencí. Ivana Rudolfová. školitel: doc. Ing. Jaroslav Zendulka, CSc. Genomické databáze Shlukování proteinových sekvencí Ivana Rudolfová školitel: doc. Ing. Jaroslav Zendulka, CSc. Obsah Proteiny Zdroje dat Predikce struktury proteinů Cíle disertační práce Vstupní data

Více

Evropský sociální fond Praha & EU: Investujeme do vaší budoucnosti. Translace, techniky práce s DNA

Evropský sociální fond Praha & EU: Investujeme do vaší budoucnosti. Translace, techniky práce s DNA Evropský sociální fond Praha & EU: Investujeme do vaší budoucnosti Translace, techniky práce s DNA Translace překlad z jazyka nukleotidů do jazyka aminokyselin dá se rozdělit na 5 kroků aktivace aminokyslin

Více

Základy analýzy potravin Přednáška 8. Důvody pro analýzu bílkovin v potravinách. určování původu suroviny, autenticita výrobku

Základy analýzy potravin Přednáška 8. Důvody pro analýzu bílkovin v potravinách. určování původu suroviny, autenticita výrobku BÍLKOVINY Důvody pro analýzu bílkovin v potravinách posuzování nutriční hodnoty celkový obsah bílkovin aminokyselinové složení bílkoviny, volné aminokyseliny obsah cizorodých nebo neplnohodnotných bílkovin

Více

Centrum aplikované genomiky, Ústav dědičných metabolických poruch, 1.LFUK

Centrum aplikované genomiky, Ústav dědičných metabolických poruch, 1.LFUK ové technologie v analýze D A, R A a proteinů Stanislav Kmoch Centrum aplikované genomiky, Ústav dědičných metabolických poruch, 1.LFUK Motto : "The optimal health results from ensuring that the right

Více

Má tajemný clusterin u dětí v septickém stavu aktivitu chaperonu? J. Žurek, P.Košut, M. Fedora

Má tajemný clusterin u dětí v septickém stavu aktivitu chaperonu? J. Žurek, P.Košut, M. Fedora Má tajemný clusterin u dětí v septickém stavu aktivitu chaperonu? J. Žurek, P.Košut, M. Fedora Klinika dětské anesteziologie a resuscitace, Lékařská fakulta MU, Fakultní nemocnice Brno DNA transkripce

Více

Sbohem, paní Bradfordová

Sbohem, paní Bradfordová Sbohem, paní Bradfordová aneb IČ spektroskopie ve službách kvantifikace proteinů Mgr. Stanislav Kukla Merck spol. s r. o. Agenda 1 Zhodnocení současných možností kvantifikace proteinů Bradfordové metoda

Více

Inovace studia molekulární a buněčné biologie

Inovace studia molekulární a buněčné biologie Inovace studia molekulární a buněčné biologie Tento projekt je spolufinancován Evropským sociálním fondem a státním rozpočtem České republiky. MBIO1/Molekulární biologie 1 Tento projekt je spolufinancován

Více

Název: Vypracovala: Datum: 7. 2. 2014. Zuzana Lacková

Název: Vypracovala: Datum: 7. 2. 2014. Zuzana Lacková Název: Vypracovala: Zuzana Lacková Datum: 7. 2. 2014 Reg.č.projektu: CZ.1.07/2.4.00/31.0023 Název projektu: Partnerská síť centra excelentního bionanotechnologického výzkumu MĚLI BYCHOM ZNÁT: informace,

Více

Laboratoř ze speciální analýzy potravin II. Úloha 3 - Plynová chromatografie (GC-MS)

Laboratoř ze speciální analýzy potravin II. Úloha 3 - Plynová chromatografie (GC-MS) 1 Úvod... 1 2 Cíle úlohy... 2 3 Předpokládané znalosti... 2 4 Autotest základních znalostí... 2 5 Základy práce se systémem GC-MS (EI)... 3 5.1 Parametry plynového chromatografu... 3 5.2 Základní charakteristiky

Více

Praktický kurz Monitorování hladiny metalothioneinu po působení iontů těžkých kovů Vyhodnocení měření

Praktický kurz Monitorování hladiny metalothioneinu po působení iontů těžkých kovů Vyhodnocení měření Laboratoř Metalomiky a Nanotechnologií Praktický kurz Monitorování hladiny metalothioneinu po působení iontů těžkých kovů Vyhodnocení měření Vyučující: Ing. et Ing. David Hynek, Ph.D., Prof. Ing. René

Více

Jednotné pracovní postupy zkoušení krmiv STANOVENÍ OBSAHU MELAMINU A KYSELINY KYANUROVÉ METODOU LC-MS

Jednotné pracovní postupy zkoušení krmiv STANOVENÍ OBSAHU MELAMINU A KYSELINY KYANUROVÉ METODOU LC-MS Národní referenční laboratoř Strana 1 STANOVENÍ OBSAHU MELAMINU A KYSELINY KYANUROVÉ METODOU LC-MS 1 Rozsah a účel Postup je určen pro stanovení obsahu melaminu a kyseliny kyanurové v krmivech. 2 Princip

Více

Hmotnostní spektrometrie

Hmotnostní spektrometrie Hmotnostní spektrometrie Podstatou hmotnostní spektrometrie je studium iontů v plynném stavu. Tato metoda v sobě zahrnuje tři hlavní části:! generování iontů sledovaných atomů nebo molekul! separace iontů

Více

Hmotnostní spektrometrie zdroj analytických informací

Hmotnostní spektrometrie zdroj analytických informací Klin. Biochem. Metab., 20 (41), 2012, No. 4, p. 210 215. Hmotnostní spektrometrie zdroj analytických informací Friedecký D. 1,2, Lemr K. 3 1 Laboratoř dědičných metabolických poruch, OKB, Fakultní nemocnice

Více

Základy interpretace hmotnostních spekter

Základy interpretace hmotnostních spekter Základy interpretace hmotnostních spekter Zpracováno podle: http://www.chem.arizona.edu/massspec/ - doporučený zdroj pro samostudium 1. Měříme četnost iontů pro dané hodnoty m/z 2. Vytvoříme grafickou

Více

Magnetické částice pro detekci nádorových onemocnění, založené na protilátkách Vojtěch Adam

Magnetické částice pro detekci nádorových onemocnění, založené na protilátkách Vojtěch Adam Název: Školitel: Magnetické částice pro detekci nádorových onemocnění, založené na protilátkách Vojtěch Adam Datum: 7..203 Reg.č.projektu: CZ..07/2.4.00/3.0023 Název projektu: Partnerská síť centra excelentního

Více

EFFECT OF CADMIUM ON TOBACCO CELL SUSPENSION BY-2

EFFECT OF CADMIUM ON TOBACCO CELL SUSPENSION BY-2 EFFECT OF CADMIUM ON TOBACCO CELL SUSPENSION BY-2 Štěpán Z., Klemš M., Zítka O., Havel L. Department of Plant Biology, Faculty of Agronomy, Mendel University in Brno, Zemědělská 1, 613 00 Brno, Czech Republic

Více

Proteinové znaky dětské leukémie identifikované pomocí genových expresních profilů

Proteinové znaky dětské leukémie identifikované pomocí genových expresních profilů Proteinové znaky dětské leukémie identifikované pomocí genových expresních profilů M.Vášková a spol. Klinika dětské hematologie a onkologie 2.LF UK a FN Motol Childhood Leukemia Investigation Prague Průtoková

Více

SPECIFICATION FOR ALDER LED

SPECIFICATION FOR ALDER LED SPECIFICATION FOR ALDER LED MODEL:AS-D75xxyy-C2LZ-H1-E 1 / 13 Absolute Maximum Ratings (Ta = 25 C) Parameter Symbol Absolute maximum Rating Unit Peak Forward Current I FP 500 ma Forward Current(DC) IF

Více

Iontové zdroje II. Iontový zdroj. Data. Vzorek. Hmotnostní analyzátor. Zdroj vakua. Iontové zdroje pracující za sníženého tlaku

Iontové zdroje II. Iontový zdroj. Data. Vzorek. Hmotnostní analyzátor. Zdroj vakua. Iontové zdroje pracující za sníženého tlaku MC230P43 Hmotnostní detekce v separačních metodách, 2015 Iontové zdroje II. Iontové zdroje pracující za sníženého tlaku Elektronová/chemická ionizace Iontové zdroje pro spojení s planárními separacemi

Více

1. Metodika. Protokol č. F1-4 Metodika: Srovnávací analýza efektivity přípravy rekombinantního proteinu ve fermentoru

1. Metodika. Protokol č. F1-4 Metodika: Srovnávací analýza efektivity přípravy rekombinantního proteinu ve fermentoru Protokol č.: F1-4 Datum: 20.12.2010 Metodika: analýza efektivity přípravy výběr z výsledků ze zkušebních provozů výroby antigenů. Vypracoval: Ing. Václav Filištein, Mgr. Tereza Chrudimská, Spolupracující

Více

Aplikace elektromigračních technik

Aplikace elektromigračních technik Aplikace elektromigračních technik Capillary electrophoresis D.L.Barker High Performance Capillary electrophoresis M.G. Khaledi Analysis and detection by capillary electrophoresis M.L.Marina (ed.) Electrophoresis

Více

Základy interpretace hmotnostních spekter měřených s použitím měkkých ionizačních technik

Základy interpretace hmotnostních spekter měřených s použitím měkkých ionizačních technik Základy interpretace hmotnostních spekter měřených s použitím měkkých ionizačních technik Pravidlo sudého počtu elektronů (Even-Electron Rule) 1/ E + EE + + R měkké ion.tech tech. 2/ EE + EE + + EI E +

Více

Možná uplatnění proteomiky směrem do klinické praxe

Možná uplatnění proteomiky směrem do klinické praxe Možná uplatnění proteomiky směrem do klinické praxe Formy uplatnění proteomiky do klinické praxe Přímé uplatnění proteomických technologií Metody pro studium proteinů tu byly dřív něž proteomika jako obor

Více

Analýza směsí, kvantitativní NMR spektroskopie a využití NMR spektroskopie ve forenzní analýze

Analýza směsí, kvantitativní NMR spektroskopie a využití NMR spektroskopie ve forenzní analýze Analýza směsí, kvantitativní NMR spektroskopie a využití NMR spektroskopie ve forenzní analýze Analýza směsí a kvantitativní NMR NMR spektrum čisté látky je lineární kombinací spekter jejích jednotlivých

Více

MOLEKULÁRNĚ BIOLOGICKÉ METODY V ENVIRONMENTÁLNÍ MIKROBIOLOGII. Martina Nováková, VŠCHT Praha

MOLEKULÁRNĚ BIOLOGICKÉ METODY V ENVIRONMENTÁLNÍ MIKROBIOLOGII. Martina Nováková, VŠCHT Praha MOLEKULÁRNĚ BIOLOGICKÉ METODY V ENVIRONMENTÁLNÍ MIKROBIOLOGII Martina Nováková, VŠCHT Praha MOLEKULÁRNÍ BIOLOGIE V BIOREMEDIACÍCH enumerace FISH průtoková cytometrie klonování produktů PCR sekvenování

Více

Vizualizace DNA ETHIDIUM BROMID. fluorescenční barva interkalační činidlo. do gelu do pufru barvení po elfu SYBR GREEN

Vizualizace DNA ETHIDIUM BROMID. fluorescenční barva interkalační činidlo. do gelu do pufru barvení po elfu SYBR GREEN ETHIDIUM BROMID fluorescenční barva interkalační činidlo do gelu do pufru barvení po elfu Vizualizace DNA SYBR GREEN Barvení proteinů Coommassie Brilliant Blue Coomassie Blue x barvení stříbrem Porovnání

Více

ZÁKLADNÍ EXPERIMENTÁLNÍ

ZÁKLADNÍ EXPERIMENTÁLNÍ Kurz praktické NMR spektroskopie 10. - 12. říjen 2011, Praha ZÁKLADNÍ EXPERIMENTÁLNÍ POSTUPY NMR ROZTOKŮ A KAPALIN Jana Svobodová Ústav Makromolekulární chemie AV ČR, v.v.i. Bruker 600 Avance III PŘÍSTROJOVÉ

Více

Techniky prvkové povrchové analýzy elemental analysis

Techniky prvkové povrchové analýzy elemental analysis Techniky prvkové povrchové analýzy elemental analysis (Foto)elektronová spektroskopie (pro chemickou analýzu) ESCA, XPS X-ray photoelectron spectroscopy (XPS) Any technique in which the sample is bombarded

Více

FIA fluorescenční imunoanalýza (fluorescence immuno-assay) CIA chemiluminiscenční imunoanalýza

FIA fluorescenční imunoanalýza (fluorescence immuno-assay) CIA chemiluminiscenční imunoanalýza FIA a CIA FIA fluorescenční imunoanalýza (fluorescence immuno-assay) CIA chemiluminiscenční imunoanalýza Značky pro antigeny a protilátky: radioizotop enzym fluorescenční sonda luminiscenční sonda kovové

Více

Aminokyseliny, proteiny, enzymy Základy lékařské chemie a biochemie 2014/2015 Ing. Jarmila Krotká Metabolismus základní projev života látková přeměna souhrn veškerých dějů, které probíhají uvnitř organismu

Více

Zdroje iont používané v hmotnostní spektrometrii. Miloslav Šanda

Zdroje iont používané v hmotnostní spektrometrii. Miloslav Šanda Zdroje iont používané v hmotnostní spektrometrii Miloslav Šanda Ionizace v MS Hmotnostní spektrometrie je fyzikáln chemická metoda, pi které se provádí separace iont podle jejich hmotnosti a náboje m/z

Více

Program 16. ročníku Školy hmotnostní spektrometrie aneb Naše spektrometrie. pořádané Spektroskopickou společností Jana Marka Marci

Program 16. ročníku Školy hmotnostní spektrometrie aneb Naše spektrometrie. pořádané Spektroskopickou společností Jana Marka Marci Program 16. ročníku Školy hmotnostní spektrometrie aneb Naše spektrometrie pořádané Spektroskopickou společností Jana Marka Marci Frymburk 13. 18. 9. 2015 Neděle 13. 9. 2015 11:00-14:00 Příjezd účastníků,

Více

Základy hmotnostní spektrometrie

Základy hmotnostní spektrometrie Základy hmotnostní spektrometrie Historie Koichi Tanaka vyvinul MALDI techniku Tanaka K., Waki H., Ido Y., Akita S., Yoshida T.: Rapid Commun. Mass Spectrom. 1988. 2, 151 Tanaka K. JB Fenn vyvinul ionizaci

Více

Základní principy interpretace spekter

Základní principy interpretace spekter Základní principy interpretace spekter Vyloučení iontů, které nesouvisí s analytem Určení molekulové hmotnosti Určení prvků přítomných v molekule Určení elementárního složení z přesné hmotnosti Hledání

Více

vzorek1 0.0033390 0.0047277 0.0062653 0.0077811 0.0090141... vzorek 30 0.0056775 0.0058778 0.0066916 0.0076192 0.0087291

vzorek1 0.0033390 0.0047277 0.0062653 0.0077811 0.0090141... vzorek 30 0.0056775 0.0058778 0.0066916 0.0076192 0.0087291 Vzorová úloha 4.16 Postup vícerozměrné kalibrace Postup vícerozměrné kalibrace ukážeme na úloze C4.10 Vícerozměrný kalibrační model kvality bezolovnatého benzinu. Dle následujících kroků na základě naměřených

Více

Hmotnostní analyzátory a detektory iont

Hmotnostní analyzátory a detektory iont Hmotnostní analyzátory a detektory iont Hmotnostní analyzátory Hmotnostní analyzátory Rozdlí ionty v prostoru nebo v ase podle jejich m/z Analyzátory Magnetický analyzátor (MAG) Elektrostatický analyzátor

Více

HPLC/MS tělních tekutin nový rozměr v medicinální diagnostice

HPLC/MS tělních tekutin nový rozměr v medicinální diagnostice HPLC/MS tělních tekutin nový rozměr v medicinální diagnostice Lukáš Chytil Ústav organické technologie VŠCHT Praha Medicinální diagnostika a hmotnostní spektrometrie Medicinální diagnostika: - Klasické

Více

PROTEOMIKA V MOLEKULÁRNÍ TOXIKOLOGII: IDENTIFIKACE POTENCIÁLNÍCH ČASNÝCH PROTEI- NOVÝCH BIOMARKERŮ HEPATO- KARCINOGENITY U KRYS

PROTEOMIKA V MOLEKULÁRNÍ TOXIKOLOGII: IDENTIFIKACE POTENCIÁLNÍCH ČASNÝCH PROTEI- NOVÝCH BIOMARKERŮ HEPATO- KARCINOGENITY U KRYS PROTEOMIKA V MOLEKULÁRNÍ TOXIKOLOGII: IDENTIFIKACE POTENCIÁLNÍCH ČASNÝCH PROTEI- NOVÝCH BIOMARKERŮ HEPATO- KARCINOGENITY U KRYS KERSTIN FELLA a, MATTHIAS GLÜCKMANN b, VOLKER KRUFT b, PETER-JÜRGEN KRAMER

Více

Chyby spektrometrických metod

Chyby spektrometrických metod Chyby spektrometrických metod Náhodné Soustavné Hrubé Správnost výsledku Přesnost výsledku Reprodukovatelnost Opakovatelnost Charakteristiky stanovení 1. Citlivost metody - směrnice kalibrační křivky 2.

Více

Lodish et al, Molecular Cell Biology, 4-6 vydání Alberts et al, Molecular Biology of the Cell, 4 vydání

Lodish et al, Molecular Cell Biology, 4-6 vydání Alberts et al, Molecular Biology of the Cell, 4 vydání Lodish et al, Molecular Cell Biology, 4-6 vydání Alberts et al, Molecular Biology of the Cell, 4 vydání http://web.natur.cuni.cz/~zdenap/zdenateachingnf.html CHEMICKÉ SLOŽENÍ BUŇKY BUŇKA: 99 % C, H, N,

Více

3/7/2014. Dávkování vzorku LC/MS. Dávkování vzorku LC/MS

3/7/2014. Dávkování vzorku LC/MS. Dávkování vzorku LC/MS motnostní spektrometrie (3) Josef Chudoba LC/MS BSA - dávkování vzorku u LC/MS - PLC chromatografie chromatogram, základní pojmy režimy PLC, mobilní fáze, kolony (stacionární fáze) - elektrosprejová ionizace

Více

Molekulární mechanismy diferenciace a programované buněčné smrti - vztah k patologickým procesům buněk. Aleš Hampl

Molekulární mechanismy diferenciace a programované buněčné smrti - vztah k patologickým procesům buněk. Aleš Hampl Molekulární mechanismy diferenciace a programované buněčné smrti - vztah k patologickým procesům buněk Aleš Hampl Tkáně Orgány Živé buňky, které plní různé funkce (podpora struktury, přijímání živin, lokomoce,

Více

Hmotnostní spektrometrie peptidů ů a proteinů Petr Halada Mikrobiologický ústav AV ČR halada@biomed.cas.cz Proč chceme znát molekulovou hmotnost? Všechny prvky a molekuly jsou charakterizovány 2 základními

Více

AMINOKYSELINY STANOVENÍ AMINOKYSELINOVÉHO SLOŽENÍ BÍLKOVIN. Stanovení sirných aminokyselin. Obecná struktura

AMINOKYSELINY STANOVENÍ AMINOKYSELINOVÉHO SLOŽENÍ BÍLKOVIN. Stanovení sirných aminokyselin. Obecná struktura AMIKYSELIY becná struktura STAVEÍ AMIKYSELIVÉH SLŽEÍ BÍLKVI 1. IZLAE (jen v některých případech) 2. HYDLÝZA kyselá hydrolýza pomocí Hl ( c = 5 mol.dm -3 ) klasicky: 105-120, 18-24 h, inertní atmosféra,

Více

Hmotnostní detekce biologicky významných sloučenin pro biotechnologie část 3 - Provedení štěpení proteinů a následné analýzy,

Hmotnostní detekce biologicky významných sloučenin pro biotechnologie část 3 - Provedení štěpení proteinů a následné analýzy, Laboratoř Metalomiky a Nanotechnologií Hmotnostní detekce biologicky významných sloučenin pro biotechnologie část 3 - Provedení štěpení proteinů a následné analýzy, vyhodnocení výsledků, diskuse Anotace

Více

Struktura a funkce biomakromolekul KBC/BPOL

Struktura a funkce biomakromolekul KBC/BPOL Struktura a funkce biomakromolekul KBC/BPOL 2. Posttranslační modifikace a skládání proteinů Ivo Frébort Biosyntéza proteinů Kovalentní modifikace proteinů Modifikace proteinu může nastat předtím než je

Více

Hmotnostní spektrometrie ve spojení se separačními metodami

Hmotnostní spektrometrie ve spojení se separačními metodami Pražské analytické centrum inovací Projekt CZ.04.3.07/4.2.01.1/0002 spolufinancovaný ESF a Státním rozpočtem ČR Hmotnostní spektrometrie ve spojení se separačními metodami Ivan Jelínek PřF UK Praha Definice:

Více

Charakterizace proteomu piva

Charakterizace proteomu piva MASARYKOVA UNIVERZITA Přírodovědecká fakulta Katedra biochemie Charakterizace proteomu piva Brno 2009 Eva Kotlasová Chtěla bych poděkovat vedoucímu své bakalářské práce RNDr. Z. Zdráhalovi, Dr. za pomoc

Více

Proteomická analýza nádorových buněk

Proteomická analýza nádorových buněk přehled Proteomická analýza nádorových buněk Proteomic Analysis of Cancer Cells Tomancová A. 1, Šedo O. 2, Zdráhal Z. 2, Mayer J. 1, Pospíšilová Š. 1 1 Centrum molekulární bio logie a genové terapie, Interní

Více

Repetitorium chemie VIII. (2014)

Repetitorium chemie VIII. (2014) Repetitorium chemie VIII. (2014) Moderní metody analýzy organických látek se zastávkou u Lambert-Beerova zákona a odhalení tajemství Bradforda/Bradfordové Odhalení tajemství: Protein Concentration Determination

Více

DNA TECHNIKY IDENTIFIKACE ŽIVOČIŠNÝCH DRUHŮ V KRMIVU A POTRAVINÁCH. Michaela Nesvadbová

DNA TECHNIKY IDENTIFIKACE ŽIVOČIŠNÝCH DRUHŮ V KRMIVU A POTRAVINÁCH. Michaela Nesvadbová DNA TECHNIKY IDENTIFIKACE ŽIVOČIŠNÝCH DRUHŮ V KRMIVU A POTRAVINÁCH Michaela Nesvadbová Význam identifikace živočišných druhů v krmivu a potravinách povinností každého výrobce je řádně a pravdivě označit

Více

Témata bakalářské a diplomové práce Počátek řešení v roce 2012

Témata bakalářské a diplomové práce Počátek řešení v roce 2012 Laboratoř pokročilých průtokových technik 1. Téma: Use of mass spectrometry technique (MALDI-TOF) for the characterization of metallothionein in biological systems Anotace: Metallothioneins (MT) are intracellular,

Více

Benzen. Standardizované metody

Benzen. Standardizované metody Zpracováno podle Raclavská, H. Kuchařová, J. Plachá, D.: Podklady k provádění Protokolu o PRTR Přehled metod a identifikace látek sledovaných podle Protokolu o registrech úniků a přenosů znečišťujících

Více

SPE je metoda vhodná pro rychlou přípravu vzorků, která užívá

SPE je metoda vhodná pro rychlou přípravu vzorků, která užívá Extrakce na pevné fázi (SPE) Příprava předmětu byla podpořena projektem OPPA č. CZ.2.17/3.1.00/33253 Extrakce na pevné fázi (SPE) (Solid Phase Extraction) SPE je metoda vhodná pro rychlou přípravu vzorků,

Více

Analýza proteinů pomocí hmotnostní spektrometrie

Analýza proteinů pomocí hmotnostní spektrometrie Analýza proteinů pomocí hmotnostní spektrometrie Analysis of Protein Using Mass Spectrometry Dvořáková P., Hernychová L., Vojtěšek B. Regionální centrum aplikované molekulární onkologie, Masarykův onkologický

Více

Glykobiologie Glykoproteomika Funkční glykomika

Glykobiologie Glykoproteomika Funkční glykomika Glykobiologie Glykoproteomika Funkční glykomika Glycobiology how sweet it is! Monosacharidy (glukosa, fruktosa, galaktosa ) Oligosacharidy (maltosa, isomaltosa, sacharosa, laktosa.., oligosacharidové řetězce

Více

VYUŽITÍ KOMERČNÍ METODY IMUNOCHEMICKÉHO ODSTRANĚNÍ RUBISCO V ANALÝZE ROSTLINNÉHO PROTEOMU

VYUŽITÍ KOMERČNÍ METODY IMUNOCHEMICKÉHO ODSTRANĚNÍ RUBISCO V ANALÝZE ROSTLINNÉHO PROTEOMU VYUŽITÍ KOMERČNÍ METODY IMUNOCHEMICKÉHO ODSTRANĚNÍ RUBISCO V ANALÝZE ROSTLINNÉHO PROTEOMU MARTIN ČERNÝ, JAN SKALÁK, BARBORA KURKOVÁ, ELENA BABULIAKOVÁ a BŘETISLAV BRZOBOHATÝ Laboratoř molekulární biologie

Více

Úvod do hmotnostní spektrometrie

Úvod do hmotnostní spektrometrie Úvod do hmotnostní spektrometrie Friedecký D. 1,2, Lemr K. 3 Klin. Biochem. Metab., 20 (41), 2012, No. 3, p. 152 157. 1 Laboratoř dědičných metabolických poruch, OKB, Fakultní nemocnice Olomouc 2 Ústav

Více

NMR biomakromolekul RCSB PDB. Progr. NMR

NMR biomakromolekul RCSB PDB. Progr. NMR NMR biomakromolekul Typy biomakromolekul a možnosti studia pomocí NMR proteiny a peptidy rozmanité složení, omezení jen velikostí molekul nukleové kyseliny (RNA, DNA) a oligonukleotidy omezení malou rozmanitostí

Více

Identifikace barviv pomocí Ramanovy spektrometrie

Identifikace barviv pomocí Ramanovy spektrometrie Identifikace barviv pomocí Ramanovy spektrometrie V kriminalistických laboratořích se provádí technická expertíza písemností, která se mimo jiné zabývá zkoumáním použitých psacích prostředků: tiskových

Více

Vývoj a inovace nových nanomateriálů pro cílenou modifikaci cévních náhrad. NanoCeva

Vývoj a inovace nových nanomateriálů pro cílenou modifikaci cévních náhrad. NanoCeva Vývoj a inovace nových nanomateriálů pro cílenou modifikaci cévních náhrad NanoCeva Řešitelská pracoviště Vysoké učení technické Brno (řešitel), Výzkumný ústav pletařský (spoluřešitel), Mendelova univerzita

Více

laktoferin BSA α S2 -CN α S1 -CN Popis: BSA bovinní sérový albumin, CN kasein, LG- laktoglobulin, LA- laktalbumin

laktoferin BSA α S2 -CN α S1 -CN Popis: BSA bovinní sérový albumin, CN kasein, LG- laktoglobulin, LA- laktalbumin Aktivita KA 2340/4-8up Stanovení bílkovin v mléce pomocí SDS PAGE (elektroforéza na polyakrylamidovém gelu s přídavkem dodecyl sulfátu sodného) vypracovala: MVDr. Michaela Králová, Ph.D. Princip: Metoda

Více

Obecné cíle a řešené dílčí etapy

Obecné cíle a řešené dílčí etapy 5.1.3. Nestacionární zkoušky motorů Obecné cíle a řešené dílčí etapy 5.1.3. Nestacionární zkoušky motorů Ověření emisního chování vozidel při simulaci různých reálných provozních podmínek Verifikace spotřeby

Více

Metabolismus aminokyselin. Vladimíra Kvasnicová

Metabolismus aminokyselin. Vladimíra Kvasnicová Metabolismus aminokyselin Vladimíra Kvasnicová Aminokyseliny aminokyseliny přijímáme v potravě ve formě proteinů: důležitá forma organicky vázaného dusíku, který tak může být v těle využit k syntéze dalších

Více

Jednotné pracovní postupy zkoušení krmiv STANOVENÍ OBSAHU MYKOTOXINŮ METODOU LC-MS - FUMONISIN B 1 A B 2

Jednotné pracovní postupy zkoušení krmiv STANOVENÍ OBSAHU MYKOTOXINŮ METODOU LC-MS - FUMONISIN B 1 A B 2 Národní referenční laboratoř Strana 1 STANOVENÍ OBSAHU MYKOTOXINŮ METODOU LC-MS - FUMONISIN B 1 A B 2 1 Rozsah a účel Metoda je vhodná pro stanovení fumonisinů B 1 a B 2 v krmivech. 2 Princip Fumonisiny

Více

Ultraúčinná kapalinová chromatografie/tandemová hmotnostní spektrometrie

Ultraúčinná kapalinová chromatografie/tandemová hmotnostní spektrometrie VÝZVA PRO PODÁNÍ NABÍDEK VEŘEJNÁ ZAKÁZKA S NÁZVEM: Ultraúčinná kapalinová chromatografie/tandemová hmotnostní spektrometrie 1. Identifikační údaje zadavatele: Název zadavatele: Univerzita Palackého v Olomouci

Více

Nadpis článku: Zavedení speciálního nástroje SYPOKUB do praxe

Nadpis článku: Zavedení speciálního nástroje SYPOKUB do praxe Oborový portál BOZPinfo.cz - http://www.bozpinfo.cz Tisknete stránku: http://www.bozpinfo.cz/josra/josra-03-04-2013/zavedeni-sypokub.html Články jsou aktuální k datumu jejich vydání. Stránka byla vytvořena/aktualizována:

Více

Proteiny Genová exprese. 2013 Doc. MVDr. Eva Bártová, Ph.D.

Proteiny Genová exprese. 2013 Doc. MVDr. Eva Bártová, Ph.D. Proteiny Genová exprese 2013 Doc. MVDr. Eva Bártová, Ph.D. Bílkoviny (proteiny), 15% 1g = 17 kj Monomer = aminokyseliny aminová skupina karboxylová skupina α -uhlík postranní řetězec Znát obecný vzorec

Více

METODY STANOVENÍ HLADIN VITAMÍNU D. Stanovení. Struktury 1α,25-dihydroxyvitamin D3 kalcitriol. Chemicky Chromatograficky Imunochemicky

METODY STANOVENÍ HLADIN VITAMÍNU D. Stanovení. Struktury 1α,25-dihydroxyvitamin D3 kalcitriol. Chemicky Chromatograficky Imunochemicky Vrzalová Jindra METODY STANOVENÍ HLADIN VITAMÍNU D Stanovení Chemicky Chromatograficky Imunochemicky Deproteinace a extrakce předcházející analýze Kyselina/zásada (denaturace bí.) + Acetonitril/hexan/metanol/benzen

Více

Harmonizace metod vyhodnocení naměřených dat při zkratových zkouškách

Harmonizace metod vyhodnocení naměřených dat při zkratových zkouškách Harmonizace metod vyhodnocení naměřených dat při zkratových zkouškách P. Křemen (Zkušebnictví, a.s.), R. Jech (Zkušebnictví, a.s) Jsou uvedeny principy a postup harmonizace metod zpracování a vyhodnocení

Více

VYUŽITÍ A VALIDACE AUTOMATICKÉHO FOTOMETRU V ANALÝZE VOD

VYUŽITÍ A VALIDACE AUTOMATICKÉHO FOTOMETRU V ANALÝZE VOD Citace Kantorová J., Kohutová J., Chmelová M., Němcová V.: Využití a validace automatického fotometru v analýze vod. Sborník konference Pitná voda 2008, s. 349-352. W&ET Team, Č. Budějovice 2008. ISBN

Více

Izolace genomové DNA ze savčích buněk, stanovení koncentrace DNA pomocí absorpční spektrofotometrie

Izolace genomové DNA ze savčích buněk, stanovení koncentrace DNA pomocí absorpční spektrofotometrie Izolace genomové DNA ze savčích buněk, stanovení koncentrace DNA pomocí absorpční spektrofotometrie IZOLACE GENOMOVÉ DNA Deoxyribonukleová kyselina (DNA) představuje základní genetický materiál většiny

Více

BIOLOGICKÉ LOUŽENÍ KAMÍNKU Z VÝROBY OLOVA

BIOLOGICKÉ LOUŽENÍ KAMÍNKU Z VÝROBY OLOVA BIOLOGICKÉ LOUŽENÍ KAMÍNKU Z VÝROBY OLOVA Dana Krištofová,Vladimír Čablík, Peter Fečko a a) Vysoká škola báňská Technická univerzita Ostrava, 17. listopadu 15, 708 33 Ostrava Poruba, ČR, dana.kristofova@vsb.cz

Více

Radiobiologický účinek záření. Helena Uhrová

Radiobiologický účinek záření. Helena Uhrová Radiobiologický účinek záření Helena Uhrová Fáze účinku fyzikální fyzikálně chemická chemická biologická Fyzikální fáze Přenos energie na e Excitace molekul, ionizace Doba trvání 10-16 - 10-13 s Fyzikálně-chemická

Více

Vazebné interakce protein s DNA

Vazebné interakce protein s DNA Vazebné interakce protein s DNA Vazebné možnosti vn jší vazba atmosféra + iont kolem nabité DNA vazba ve žlábku van der Waalsovský kontakt s lé ivem ve žlábku interkalace vmeze ení planárního aromat.

Více

KALIBRACE. Definice kalibrace: mezinárodní metrologický slovník (VIM 3)

KALIBRACE. Definice kalibrace: mezinárodní metrologický slovník (VIM 3) KALIBRACE Chemometrie I, David MILDE Definice kalibrace: mezinárodní metrologický slovník (VIM 3) Činnost, která za specifikovaných podmínek v prvním kroku stanoví vztah mezi hodnotami veličiny s nejistotami

Více

Činnost a aktivity zdravotníků v oblasti klonování a GMO

Činnost a aktivity zdravotníků v oblasti klonování a GMO Konference ZV PS ČR Klonování a GMO dne 7. 5. 2015 v Praze Činnost a aktivity zdravotníků v oblasti klonování a GMO Vladimír Ostrý Státní zdravotní ústav v Praze Centrum zdraví, výživy a potravin v Brně

Více