Kvantitativní proteomická analýza

Rozměr: px
Začít zobrazení ze stránky:

Download "Kvantitativní proteomická analýza"

Transkript

1 Kvantitativní proteomická analýza Martin Hubálek Kvantifikace proteinů Většinou pouze relativní srovnání odezvy mezi dvěma experimenty, případně mezi experimentem a standardem Množství proteinu bývá odvozeno z množství jednoho nebo více peptidů z proteinové sekvence Založené na porovnání výšky nebo plochy píku Peptidu(s) m/z (MS úroveň MS1) Fragmentu peptidu m/z (MS/MS úroveň MS2) Důležitý výběr peptidu Proteotypický peptid

2 Kvantifikace proteinů Bezznačková (Labelfree) MS1 MS2 Stabilní Izotopové značení ( stable isotope labelling) 2DE Cílená SRM Data Independent Analysis (DIA) SWATH Metabolické SILAC 14 N/ 15 N medium MS1 mtraq Nterm Dimethyl MS2 itraq TMT Chemické Cterm Esterifikace 16 O/ 18 O inkorporace Aminokyselina Lys (itraq) Cys (ICAT) Trp Proteotypický peptid Peptidy, které je možné zaznamenat pomocí LC MS Štěpitelné použitou proteázou (nejčastěji trypsin) Bez možných variabilních modifikaci (Met, Trp) Správná retence na C18 Ionizace v nanoesi Peptidy, které jsou specifické pro stanovovaný protein ve směsi s ostatními proteiny Prohledání sekvence proti všem dostupným proteinovým sekvencím

3 PEPTIDERANK Predikce proteotypických peptidů MKSINILSFLLLSSTLSLVAFARSFTSENPIVLPTTCHDDDNLVLPEVYDQDGNPLRIGERY IINNPLLGAGAVYLYNIGNLQCPNAVLQHMSIPQFLGEGTPVVFVRKSESDYGDVVRVMTVV YIKFFVKTTKLCVDQTVWKVNDEQLVVTGGKVGNENDIFKIMKTDLVTPGGSKYVYKLLHCP SHLGCKNIGGNFKNGYPRLVTVDDDKDFIPFVFIKA Bezznačkové metody

4 Kvantifikace proteinů Bezznačková (Labelfree) MS1 MS2 Stabilní Izotopové značení ( stable isotope labelling) 2DE Cílená SRM Data Independent Analysis (DIA) SWATH Metabolické SILAC 14 N/ 15 N medium MS1 mtraq Nterm Dimethyl MS2 itraq TMT Chemické Cterm Esterifikace 16 O/ 18 O inkorporace Aminokyselina Lys (itraq) Cys (ICAT) Trp Selected Reaction Monitoring (SRM)

5 Selected Reaction Monitoring (SRM) Cílený přístup Výběr prekursoru (Peptide m/z) Q1 Fragmentace v kolizní cele Q2 Sken fragmentu (Peptide fragment m/z) Q3 Quantitation MS APLDNDIGVSEATR (Beta-galaktosidáza) e4 % m/z MSMS 100 y1 y3 y5 y6 y7 y8 y9 y10 y11 y12 y13 R TA ES V G I D N D L P A b2 b4 b % Přechody: ID Q1 Q3 CE m/z APLDNDIGVSEATRy8 729,4 832,5 42 APLDNDIGVSEATRy12 729,4 1289,6 42 APLDNDIGVSEATRy11 729,4 1176,6 42

6 XIC of MRM (80 pairs): 729,4/1176,6 Da ID: APLDNDIGVSEATR from Sample... Max. 1,8e5 cps. 1,8e5 1,6e5 1,4e5 729,4 832,5 1,2e5 1,0e5 8,0e4 6,0e4 4,0e4 2,0e4 0, Time, min XIC of MRM (80 pairs): 729,4/832,5 Da ID: APLDNDIGVSEATR from Sample... Max. 1,4e5 cps. 1,4e5 1,2e5 1,0e5 8,0e4 6,0e4 4,0e4 2,0e4 729,4 1176,6 XIC of MRM (80 pairs): 729,4/1176,6 Da ID: APLDNDIGVSEATR from Sample... 1,8e5 1,6e5 1,4e5 1,2e5 1,0e5 8,0e4 Max. 1,8e5 cps. 0, Time, min XIC of MRM (80 pairs): 729,4/1289,6 Da ID: APLDNDIGVSEATR from Sample... 1,28e5 1,20e5 1,00e5 8,00e4 6,00e4 4,00e4 Max. 1,3e5 cps. 729,4 1289,6 6,0e4 4,0e4 2,0e4 0, Time, min 2,00e4 0, Time, min Skyline sw pro tvorbu SRM přechodů i vyhodnocení výsledků Selekce nábojového stavu Selekce přechodů Optimalizace kolizní energie Finální metoda

7 Scheduled MRM maximalizace cyklu monitoruje každý MRM přechod jen očekávaném elučním čase redukuje počet překrývajících se přechodů zvyšuje čas měření pro každý přechod zlepšuje analytickou přesnost lepší LLOQ Cycle Time mnoho MRM málo MRM Intensity (cps) MRM XIC Time (mins)

8 AQUA Absolutní kvantifikace Stabilně izotopicky značený peptid o stejné sekvenci jakou kvantifikuji Peak ratio Light x Heavy PeptideSequence ProteinName ReplicateName Absolute spike RT RatioToStandard AGPESDGQFQFTGIK sp Q9JJW3 USMG5_RAT _RHD50G50 50 fmol THSDQFLVSFK tr Q6PCU0 Q6PCU0_RAT _RHD50G50 50 fmol Absolutní koncetrace proteinu USMG5: 50 * 4,0401 = 202 fmol Q6PCU0: 50* 4,0608 = 203 fmol

9 Full Dynamic Range Proteome Analysis of S. cerevisiae by Targeted Proteomics Figure 1 Cellular Concentrations of the Set of Measured Proteins Protein abundances are derived from Ghaemmaghami et al. (2003). Proteins detected by SRM assays are sorted by abundance to show the even distribution across the whole range of concentration (blue circles). Proteins for which the absolute abundance was measured using isotopicallylabeled standards are indicated on top of the graph (open circles). SRM (MRM) peptidů Vysoce selektivní Široký dynamický rozsah

10 SWATH SWATHMS: Sequential Windowed data independent Acquisition of the Total Highresolution Mass Spectra Selekční okno prekurzoru kolem 25 mu (v SRM jednotka m/z) Fragmentacev kolizní cele MS/MS scan pro všechny prekurzory v cele fragmenty ze všech dohromady TripleTOF 5600 SWATHMS Adapted from Gillet et. al., Molecular & Cellular Proteomics, 2012

11 Příklad Affinity Purification coupled to Mass Spectrometry Cell culture Lysate Affinity purification Cloning Nterminally FLAG Ddi2 ptretight vector Hit verification Identification of hits Quantitative MS analysis Peptide preparation

12 Plot of Ttest tvalue versus pvalue. Red marks higlight proteins positively enriched in Ddi2 expressing cells Interakční proteiny Accession number Protein Name tvalue pvalue Fold Change sp P62987 RL40_HUMAN Ubiquitin60S ribosomal protein L E sp P54727 RD23B_HUMAN UV excision repair protein RAD23 homolog B E sp P11142 HSP7C_HUMAN Heat shock cognate 71 kda protein E sp P08107 HSP71_HUMAN Heat shock 70 kda protein 1A/1B E sp O95757 HS74L_HUMAN Heat shock 70 kda protein 4L E sp P34932 HSP74_HUMAN Heat shock 70 kda protein E sp Q15424 SAFB1_HUMAN Scaffold attachment factor B E sp P38646 GRP75_HUMAN Stress70 protein, mitochondrial E sp P11021 GRP78_HUMAN 78 kda glucoseregulated protein E

13 a) b) Fig 5.: example of manual curation of statistical result. Proteins a) UV excision repair protein RAD23 homolog B, and protein b) was assigned significant by Ttest analysis. The manual curation of protein b) disproved the result. Stabilní izotopové značení Stabilní izotopy Těžké (heavy): 13 C, 15 N, 18 O, 2 H Lehké (light): 12 C, 14 N, 16 O, 1 H Zavedení jednoho atomu Trypsinové štěpení v H 2 18 O 15 N značené v buněčné kultuře Zavedení skupiny s několika těžkými izotopy Stable isotope labelling of amino acids in cell culture (SILAC) Isobaric tag for relative and absolute quantitation (itraq) Dimethyl labelling předpoklad Shodné chování v průběhu chromatografie a ionizace odpovídající H/L formy peptidu eluují ve stejný čas obě formy mají stejnou pravděpodobnost ionizace na pozadí danné matrice

14 Kvantifikace proteinů Bezznačková (Labelfree) MS1 MS2 Stabilní Izotopové značení ( stable isotope labelling) 2DE Cílená SRM Data Independent Analysis (DIA) SWATH Metabolické SILAC 14 N/ 15 N medium MS1 mtraq Nterm Dimethyl MS2 itraq TMT Chemické Cterm Esterifikace 16 O/ 18 O inkorporace Aminokyselina Lys (itraq) Cys (ICAT) Trp DOI: /B618553N

15 Stabilní izotopové značení Metabolické Eg. SILAC Chemické Eg. Dimethyl labeling Značení stabilními izotopy - SILAC o Stable Isotope Labeling with amino ACids in cell culture (SILAC) o Metoda relativní kvantifikace proteinů ve dvou paralelně kultivovaných buněčných kulturách v médiu s lehkými nebo těžkými AK. o V mediu s těžkými AK se používá např.: Arg, Lys 13 C, 15 N o Kvantifikace MS1, ověření identity v MS2 o Nutné dosáhnout vysoké úrovně inkorporace těžkých AK do buněk o Minimálně 5 buněčných cyklů MS spektrum 2x nabitých iontů při SILAC experimentu 37

16 SILAC Inkorporace Inkorporace těžkých AK ( 13 C 15 N Arg, Lys) do buněčné kultury Protein selection Peptide selection H/L ratio = 35 i.e. incorporation level 97 % SILAC výsledek

17 SILAC Vzorky jsou smíseny na počátku experimentu Vhodné pro složité postupy přípravy vzorku Je možné použít shotgun i cílený přístup Auxotrofie pro Lys, Arg Snadné pouze v buněčných kulturách Metabolická konverze Arg na Pro Limitovaná multiplicita drahé Kvantifikace proteinů Bezznačková (Labelfree) MS1 MS2 Stabilní Izotopové značení ( stable isotope labelling) 2DE Cílená SRM Data Independent Analysis (DIA) SWATH Metabolické SILAC 14 N/ 15 N medium Nterm MS1 mtraq Dimethyl MS2 itraq TMT Chemické Cterm Esterifikace 16 O/ 18 O inkorporace Aminokyselina Lys (itraq) Cys (ICAT) Trp

18

19 Reakce Ntermini a εamino skupiny Lys s formaldehydem následovanou redukcí kyanoborohydridem sodným Dimethyl Labeling Boersema, P. J., et al. Triplex protein quantification based on stable isotope labeling by peptide dimethylation applied to cell and tissue lysates. Proteomics. 8, 2008, pp Dimethyl labelling Levné a snadno sehnatelné reagencie Reakce rychlá V roztoku po štěpení ostatní primarní aminy mohou reagovat s formaldehydem vynechat Tris, Am. Bic, použij TEAB Všechny kroky před smísením kriticky důležité pro kvantifikaci optimalizace

20 Izobarická značka pro rel. a abs. kvantifikaci itraq Isobaric Tag for Relative and Absolute Quantitation (itraq) Současná (relativní) kvantifikace až 4 vzorků. Sada 4 izobarických činidel, která se váží na aminoskupinu peptidů (proteinů). V MS mají stejný poměr m/z, v MS/MS poskytují 4 různé ionty. MS MS/MS Isobarická značka 145 Da itraq značky Relativní kvantifikace podle intenzit iontů m/z 114, 115, 116, 117 Možný i oktaplex 39 itraq Poměry jsou odečteny po peptidové fragmentaci MS/MS (MS2): Reporterové ionty a jejich poměry určují rozdíly v kvantitě

21 itraq Levnější než SILAC Reakce rychlá V roztoku po štěpení Stejné chování peptidu v průběhu analýzy až na rozdíl v MSMS spektru ostatní primarní aminy mohou reagovat s formaldehydem vynechat Tris, Am. Bic, použij TEAB Všechny kroky před smísením kriticky důležité pro kvantifikaci optimalizace Skutečné rozdíly v kvantitě jsou větší než naměřené Kvantifikace proteinů Bezznačková (Labelfree) MS1 MS2 Stabilní Izotopové značení ( stable isotope labelling) 2DE Cílená SRM Data Independent Analysis (DIA) SWATH Metabolické SILAC 14 N/ 15 N medium Nterm MS1 mtraq Dimethyl MS2 itraq TMT Chemické Cterm Esterifikace 16 O/ 18 O inkorporace Aminokyselina Lys (itraq) Cys (ICAT) Trp

22 Dvoudimensionální elektroforéza 2DE princip metody První dimense pi 3 pi 10 _ Polyakrylamidový gel Druhá dimense 2DE relativní kvantifikace

Gel-based a Gel-free kvantifikace v proteomice

Gel-based a Gel-free kvantifikace v proteomice Gel-based a Gel-free kvantifikace v proteomice Juraj Lenčo Ústav molekulární patologie Fakulta vojenského zdravotnictví U Hradec Králové Funkce proteinů Proteomika Lokalizace proteinů Proteinové interakce

Více

MENÍ A INTERPRETACE SPEKTER BIOMOLEKUL. Miloslav Šanda

MENÍ A INTERPRETACE SPEKTER BIOMOLEKUL. Miloslav Šanda MENÍ A INTERPRETACE SPEKTER BIOMOLEKUL Miloslav Šanda Ionizaní techniky využívané k analýze biomolekul (biopolymer) MALDI : proteiny, peptidy, oligonukleotidy, sacharidy ESI : proteiny, peptidy, oligonukleotidy,

Více

Indentifikace molekul a kvantitativní analýza pomocí MS

Indentifikace molekul a kvantitativní analýza pomocí MS Indentifikace molekul a kvantitativní analýza pomocí MS Identifikace molekul snaha určit molekulovou hmotnost, sumární složení, strukturní části molekuly (funkční skupiny, aromatická jádra, alifatické

Více

: nízkokroková nízkokroková ( a al a ýza analýza analýza komplexního komplexního vzorku proteinů protein /peptid

: nízkokroková nízkokroková ( a al a ýza analýza analýza komplexního komplexního vzorku proteinů protein /peptid přímá kvantitativní analýza v HPLC MS (bez izotopového otopoého značení) Jan Havliš Masarykova univerzita Přírodovědecká fakulta, Brno Ústav experimentální biologie : Oddělení funkční genomikya proteomiky

Více

Základy hmotnostní spektrometrie

Základy hmotnostní spektrometrie Základy hmotnostní spektrometrie Lenka Hernychová e-mail: hernychova@pmfhk.cz Ústav molekulární patologie, Fakulta vojenského zdravotnictví, Universita obrany Hradec Králové Historie Koichi Tanaka vyvinul

Více

Aplikace hmotnostní spektrometrie. Hmotnostní spektrometr měří pouze hmotnost, na nás je jak toho využijeme.

Aplikace hmotnostní spektrometrie. Hmotnostní spektrometr měří pouze hmotnost, na nás je jak toho využijeme. Aplikace hmotnostní spektrometrie Hmotnostní spektrometr měří pouze hmotnost, na nás je jak toho využijeme. Peptide mass fingerprinting Rozštěpení neznámého proteinu specificky štěpící proteasou. Stanovení

Více

Hmotnostní spektrometrie

Hmotnostní spektrometrie Hmotnostní spektrometrie Princip: 1. Ze vzorku jsou tvořeny ionty na úrovni molekul, nebo jejich zlomků (fragmentů), nebo až volných atomů dodáváním energie, např. uvolnění atomů ze vzorku nebo přímo rozštěpení

Více

Kapalinová chromatografie s tandemovou hmotnostní detekcí Teoretický úvod

Kapalinová chromatografie s tandemovou hmotnostní detekcí Teoretický úvod Kapalinová chromatografie s tandemovou hmotnostní detekcí Teoretický úvod Vysokoúčinná kapalinová chromatografie s tandemovou hmotnostní detekcí se řadí mezi nejcitlivější separační metody určené ke kvantitativní

Více

Hmotnostní spektrometrie Mass spectrometry - MS

Hmotnostní spektrometrie Mass spectrometry - MS Hmotnostní spektrometrie Mass spectrometry - MS Příprava předmětu byla podpořena projektem OPPA č. CZ.2.17/3.1.00/33253 Hmotnostní spektrometrie Mass spectrometry - MS hmotnostní spektroskopie versus hmotnostní

Více

LABORATOŘ OBORU I ÚSTAV ORGANICKÉ TECHNOLOGIE (111) Použití GC-MS spektrometrie

LABORATOŘ OBORU I ÚSTAV ORGANICKÉ TECHNOLOGIE (111) Použití GC-MS spektrometrie LABORATOŘ OBORU I ÚSTAV ORGANICKÉ TECHNOLOGIE (111) C Použití GC-MS spektrometrie Vedoucí práce: Doc. Ing. Petr Kačer, Ph.D., Ing. Kamila Syslová Umístění práce: laboratoř 79 Použití GC-MS spektrometrie

Více

Masarykova univerzita. Přírodovědecká fakulta Katedra biochemie. Nejnovější proteomické technologie

Masarykova univerzita. Přírodovědecká fakulta Katedra biochemie. Nejnovější proteomické technologie Masarykova univerzita Přírodovědecká fakulta Katedra biochemie Nejnovější proteomické technologie Bakalářská práce Jarmila Sobotková Brno 2006 Chtěla bych poděkovat RNDr. Zbyňkovi Zdráhalovi Dr., za poskytnutí

Více

Stanovení koncentrace (kvantifikace) proteinů

Stanovení koncentrace (kvantifikace) proteinů Stanovení koncentrace (kvantifikace) proteinů Bioanalytické metody Prof. RNDr. Pavel Peč, CSc. Úvod Kritéria výběru metod stanovení koncentrace proteinů jsou založena na možnostech pro vlastní analýzu,

Více

Pražské analytické centrum inovací Projekt CZ / /0002 spolufinancovaný ESF a Státním rozpočtem ČR

Pražské analytické centrum inovací Projekt CZ / /0002 spolufinancovaný ESF a Státním rozpočtem ČR Pražské analytické centrum inovací Projekt CZ.04.3.07/4.2.01.1/0002 spolufinancovaný ESF a Státním rozpočtem ČR SEPARACE PROTEINŮ Preparativní x analytická /měřítko, účel/ Zvláštnosti dané povahou materiálu

Více

Zpráva ze zahraniční odborné stáže

Zpráva ze zahraniční odborné stáže Zpráva ze zahraniční odborné stáže Zahraniční odborná stáž byla realizována v rámci projektu ROZVOJ A POSÍLENÍ SPOLUPRÁCE MEZI AKADEMICKÝMI A SOUKROMÝMI SUBJEKTY SE ZAMĚŘENÍM NA CHEMICKÝ A FARMACEUTICKÝ

Více

Hmotnostní spektrometrie. Historie MS. Schéma MS

Hmotnostní spektrometrie. Historie MS. Schéma MS Hmotnostní spektrometrie MS mass spectrometry MS je analytická technika, která se používá k měření poměru hmotnosti ku náboji (m/z) u iontů původně studium izotopového složení dnes dynamicky se vyvíjející

Více

Typizace amyloidóz pomocí laserové mikrodisekce a hmotnostní spektrometrie

Typizace amyloidóz pomocí laserové mikrodisekce a hmotnostní spektrometrie Typizace amyloidóz pomocí laserové mikrodisekce a hmotnostní spektrometrie Dušan Holub Laboratoř experimentální medicíny, Ústav molekulární a translační medicíny Lékařské fakulty Univerzity Palackého v

Více

Identifikace proteinu (z gelu nebo z roztoku)

Identifikace proteinu (z gelu nebo z roztoku) LC/MS a CE/MS v proteomické analýze OBSAH Příklad jednoduché analýzy Separční techniky MS techniky Identifikace proteinů Určení molekulové hmotnosti Analytická výzva Mgr. Martin Hubálek, Ph.D. Ústav organické

Více

volba separace pro následnou MS kvantifikaci proteinů Jan Havliš Masarykova univerzita Přírodovědecká fakulta, Brno Ústav experimentální biologie : Oddělení funkční genomiky a proteomiky :: Centrální laboratoř

Více

HMOTNOSTNÍ SPEKTROMETRIE - kvalitativní i kvantitativní detekce v GC a LC - pyrolýzní hmotnostní spektrometrie - analýza polutantů v životním

HMOTNOSTNÍ SPEKTROMETRIE - kvalitativní i kvantitativní detekce v GC a LC - pyrolýzní hmotnostní spektrometrie - analýza polutantů v životním HMOTNOSTNÍ SPEKTROMETRIE - kvalitativní i kvantitativní detekce v GC a LC - pyrolýzní hmotnostní spektrometrie - analýza polutantů v životním prostředí - farmakokinetické studie - kvantifikace proteinů

Více

Extrakce. Dělení podle způsobů provedení -Jednostupňová extrakce - mnohastupňuvá extrakce - kontinuální extrakce

Extrakce. Dělení podle způsobů provedení -Jednostupňová extrakce - mnohastupňuvá extrakce - kontinuální extrakce Extrakce Slouží k izolaci, oddělení analytu nebo skupin látek s podobnými vlastnostmi od matrice a ostatních látek, které nejsou předmětem analýzy (balasty). Extrakce je založena na ustavení rovnováhy

Více

Vývoj biomarkerů. Jindra Vrzalová, Ondrej Topolčan, Radka Fuchsová FN Plzeň, LF v Plzni UK

Vývoj biomarkerů. Jindra Vrzalová, Ondrej Topolčan, Radka Fuchsová FN Plzeň, LF v Plzni UK Vývoj biomarkerů Jindra Vrzalová, Ondrej Topolčan, Radka Fuchsová FN Plzeň, LF v Plzni UK Proč potřebujeme laboratoř? Proč potřebujeme biomarkery? Časná diagnostika Správná diagnostika a stratifikace pacientů

Více

Diagnostika bronchiálního. ho astmatu HPLC/MS analýzou. Kamila Syslová Ústav organické technologie

Diagnostika bronchiálního. ho astmatu HPLC/MS analýzou. Kamila Syslová Ústav organické technologie Diagnostika bronchiálního ho astmatu HPLC/MS analýzou Kamila Syslová Ústav organické technologie Bronchiální astma Civilizační onemocnění rostoucí počet případů snižující se věková hranice prvních projevů

Více

Metody používané v MB. analýza proteinů, nukleových kyselin

Metody používané v MB. analýza proteinů, nukleových kyselin Metody používané v MB analýza proteinů, nukleových kyselin Nukleové kyseliny analýza a manipulace Elektroforéza (délka fragmentů, čistota, kvantifikace) Restrikční štěpení (manipulace s DNA, identifikace

Více

Příprava vzorků pro proteomickou analýzu

Příprava vzorků pro proteomickou analýzu Příprava vzorků pro proteomickou analýzu 1) Úvod Proteomické analýzy mohou být naprosto odlišné cíle... Detekce změn v mozkové kůře při Alzheimerově chorobě Identifikace plazmatických markerů karcinomu

Více

Metody práce s proteinovými komplexy

Metody práce s proteinovými komplexy Metody práce s proteinovými komplexy Zora Nováková, Zdeněk Hodný Proteinové komplexy tvořeny dvěma a více proteiny spojenými nekovalentními vazbami Van der Waalsovy síly vodíkové můstky hydrofobní interakce

Více

Strategie peptidp. sekvenování. Derivatizace: Chemically Assisted Fragmentation CAF. 2 O značení. Esterifikace (EtOH: 28 Da / COOH skupinu)

Strategie peptidp. sekvenování. Derivatizace: Chemically Assisted Fragmentation CAF. 2 O značení. Esterifikace (EtOH: 28 Da / COOH skupinu) Hmotnostní spektrometrie v analýze biomolekul Kontrola kvality/čistoty Určení MW Identifikace Sekvenování Charakterizace modifikací Studium nekovalentních komplexů Analýza směsí Kvantifikace Studium 3D

Více

STANOVENÍ AMINOKYSELINOVÉHO SLOŽENÍ BÍLKOVIN. Postup stanovení aminokyselinového složení

STANOVENÍ AMINOKYSELINOVÉHO SLOŽENÍ BÍLKOVIN. Postup stanovení aminokyselinového složení STANVENÍ AMINKYSELINVÉH SLŽENÍ BÍLKVIN Důvody pro stanovení AK složení určení nutriční hodnoty potraviny, suroviny (esenciální vs. neesenciální AK) charakterizace určité bílkovinné frakce nebo konkrétní

Více

EXTRAHOVATELNÉ A LOUHOVATELNÉ LÁTKY. (E&L extractables/leachables) Lukáš Plaček

EXTRAHOVATELNÉ A LOUHOVATELNÉ LÁTKY. (E&L extractables/leachables) Lukáš Plaček EXTRAHOVATELNÉ A LOUHOVATELNÉ LÁTKY (E&L extractables/leachables) Lukáš Plaček 2 Extrahovatelné a louhovatelné látky (E&L) Extrahovatelné a louhovatelné látky (E&L) EXTRACTABLE Chemické látky, které se

Více

CRH/NPU I - Systém pro ultraúčinnou kapalinovou chromatografii (UHPLC) ve spojení s tandemovým hmotnostním spektrometrem (MS/MS)

CRH/NPU I - Systém pro ultraúčinnou kapalinovou chromatografii (UHPLC) ve spojení s tandemovým hmotnostním spektrometrem (MS/MS) ODŮVODNĚNÍ VEŘEJNÉ ZAKÁZKY v souladu s 156 zákona č. 137/2006, Sb., o veřejných zakázkách, ve znění pozdějších předpisů Nadlimitní veřejná zakázka na dodávky zadávaná v otevřeném řízení v souladu s ust.

Více

Stručná historie hmotnostní spektrometrie. Analytická chemie II: Úvod do hmotnostní spektrometrie. Stručná historie hmotnostní spektrometrie.

Stručná historie hmotnostní spektrometrie. Analytická chemie II: Úvod do hmotnostní spektrometrie. Stručná historie hmotnostní spektrometrie. ACh II - MS Analytická chemie II: Úvod do hmotnostní spektrometrie Jan Preisler 3A14, Ústav chemie PřF MU, UKB, tel.: 54949 6629 preisler@chemi.muni.cz Specializovaný kurz: C7895 Hmotnostní spektrometrie

Více

Analytická technika HPLC-MS/MS a možnosti jejího využití v hygieně

Analytická technika HPLC-MS/MS a možnosti jejího využití v hygieně Analytická technika HPLC-MS/MS a možnosti jejího využití v hygieně Šárka Dušková 24. září 2015-61. konzultační den Hodnocení expozice chemickým látkám na pracovištích 1 HPLC-MS/MS HPLC high-performance

Více

Evropský sociální fond Praha & EU: Investujeme do vaší budoucnosti URČOVÁNÍ PRIMÁRNÍ STRUKTURY BÍLKOVIN

Evropský sociální fond Praha & EU: Investujeme do vaší budoucnosti URČOVÁNÍ PRIMÁRNÍ STRUKTURY BÍLKOVIN Evropský sociální fond Praha & EU: Investujeme do vaší budoucnosti URČOVÁNÍ PRIMÁRNÍ STRUKTURY BÍLKOVIN Primární struktura primární struktura bílkoviny je dána pořadím AK jejích polypeptidových řetězců

Více

Hmotnostní spektrometrie - Mass Spectrometry (MS)

Hmotnostní spektrometrie - Mass Spectrometry (MS) Hmotnostní spektrometrie - Mass Spectrometry (MS) Další pojem: Hmotnostně spektrometrický (selektivní) detektor - Mass spectrometric (selective) detector (MSD) Spektrometrie - metoda založená na interakci

Více

Pondělí 10. září 2007

Pondělí 10. září 2007 Pondělí 10. září 2007 8:00-13:00 Příjezd účastníků, registrace, instalace stánků 12:00-13:00 Oběd Sekce 1: Úvod do hmotnostní spektrometrie (předsedající: M. Ryska, V. Havlíček) 13:00-13:10 J. Čáslavský

Více

IZOLACE, SEPARACE A DETEKCE PROTEINŮ I. Vlasta Němcová, Michael Jelínek, Jan Šrámek

IZOLACE, SEPARACE A DETEKCE PROTEINŮ I. Vlasta Němcová, Michael Jelínek, Jan Šrámek IZOLACE, SEPARACE A DETEKCE PROTEINŮ I Vlasta Němcová, Michael Jelínek, Jan Šrámek Studium aktinu, mikrofilamentární složky cytoskeletu pomocí dvou metod: detekce přímo v buňkách - fluorescenční barvení

Více

Emise vyvolaná působením fotonů nebo částic

Emise vyvolaná působením fotonů nebo částic Emise vyvolaná působením fotonů nebo částic PES (fotoelektronová spektroskopie) XPS (rentgenová fotoelektronová spektroskopie), ESCA (elektronová spektroskopie pro chemickou analýzu) UPS (ultrafialová

Více

METODY STUDIA PROTEINŮ

METODY STUDIA PROTEINŮ METODY STUDIA PROTEINŮ Mgr. Vlasta Němcová vlasta.furstova@tiscali.cz OBSAH PŘEDNÁŠKY 1) Stanovení koncentrace proteinu 2) Stanovení AMK sekvence proteinu Hmotnostní spektrometrie Edmanovo odbourávání

Více

Moderní nástroje v analýze biomolekul

Moderní nástroje v analýze biomolekul Moderní nástroje v analýze biomolekul Definice Hmotnostní spektrometrie (zkratka MS z anglického Mass spectrometry) je fyzikálně chemická metoda. Metoda umožňující určit molekulovou hmotnost chemických

Více

ANORGANICKÁ HMOTNOSTNÍ SPEKTROMETRIE

ANORGANICKÁ HMOTNOSTNÍ SPEKTROMETRIE ANORGANICKÁ HMOTNOSTNÍ SPEKTROMETRIE (c) David MILDE 2003-2010 Metody anorganické MS ICP-MS hmotnostní spektrometrie s indukčně vázaným plazmatem, GD-MS spojení doutnavého výboje s MS, SIMS hmotnostní

Více

Jednotné pracovní postupy zkoušení krmiv STANOVENÍ OBSAHU NEPOVOLENÝCH DOPLŇKOVÝCH LÁTEK METODOU LC-MS

Jednotné pracovní postupy zkoušení krmiv STANOVENÍ OBSAHU NEPOVOLENÝCH DOPLŇKOVÝCH LÁTEK METODOU LC-MS Národní referenční laboratoř Strana 1 STANOVENÍ OBSAHU NEPOVOLENÝCH DOPLŇKOVÝCH LÁTEK METODOU LC-MS 1 Účel a rozsah Tato metoda specifikuje podmínky pro stanovení nepovolených doplňkových látek Zn-bacitracinu,

Více

Metabolismus bílkovin. Václav Pelouch

Metabolismus bílkovin. Václav Pelouch ZÁKLADY OBECNÉ A KLINICKÉ BIOCHEMIE 2004 Metabolismus bílkovin Václav Pelouch kapitola ve skriptech - 3.2 Výživa Vyvážená strava člověka musí obsahovat: cukry (50 55 %) tuky (30 %) bílkoviny (15 20 %)

Více

Základy analýzy potravin Přednáška 8. Důvody pro analýzu bílkovin v potravinách. určování původu suroviny, autenticita výrobku

Základy analýzy potravin Přednáška 8. Důvody pro analýzu bílkovin v potravinách. určování původu suroviny, autenticita výrobku BÍLKOVINY Důvody pro analýzu bílkovin v potravinách posuzování nutriční hodnoty celkový obsah bílkovin aminokyselinové složení bílkoviny, volné aminokyseliny obsah cizorodých nebo neplnohodnotných bílkovin

Více

Genomické databáze. Shlukování proteinových sekvencí. Ivana Rudolfová. školitel: doc. Ing. Jaroslav Zendulka, CSc.

Genomické databáze. Shlukování proteinových sekvencí. Ivana Rudolfová. školitel: doc. Ing. Jaroslav Zendulka, CSc. Genomické databáze Shlukování proteinových sekvencí Ivana Rudolfová školitel: doc. Ing. Jaroslav Zendulka, CSc. Obsah Proteiny Zdroje dat Predikce struktury proteinů Cíle disertační práce Vstupní data

Více

Evropský sociální fond Praha & EU: Investujeme do vaší budoucnosti. Translace, techniky práce s DNA

Evropský sociální fond Praha & EU: Investujeme do vaší budoucnosti. Translace, techniky práce s DNA Evropský sociální fond Praha & EU: Investujeme do vaší budoucnosti Translace, techniky práce s DNA Translace překlad z jazyka nukleotidů do jazyka aminokyselin dá se rozdělit na 5 kroků aktivace aminokyslin

Více

Má tajemný clusterin u dětí v septickém stavu aktivitu chaperonu? J. Žurek, P.Košut, M. Fedora

Má tajemný clusterin u dětí v septickém stavu aktivitu chaperonu? J. Žurek, P.Košut, M. Fedora Má tajemný clusterin u dětí v septickém stavu aktivitu chaperonu? J. Žurek, P.Košut, M. Fedora Klinika dětské anesteziologie a resuscitace, Lékařská fakulta MU, Fakultní nemocnice Brno DNA transkripce

Více

Laboratoř ze speciální analýzy potravin II. Úloha 3 - Plynová chromatografie (GC-MS)

Laboratoř ze speciální analýzy potravin II. Úloha 3 - Plynová chromatografie (GC-MS) 1 Úvod... 1 2 Cíle úlohy... 2 3 Předpokládané znalosti... 2 4 Autotest základních znalostí... 2 5 Základy práce se systémem GC-MS (EI)... 3 5.1 Parametry plynového chromatografu... 3 5.2 Základní charakteristiky

Více

Centrum aplikované genomiky, Ústav dědičných metabolických poruch, 1.LFUK

Centrum aplikované genomiky, Ústav dědičných metabolických poruch, 1.LFUK ové technologie v analýze D A, R A a proteinů Stanislav Kmoch Centrum aplikované genomiky, Ústav dědičných metabolických poruch, 1.LFUK Motto : "The optimal health results from ensuring that the right

Více

Sbohem, paní Bradfordová

Sbohem, paní Bradfordová Sbohem, paní Bradfordová aneb IČ spektroskopie ve službách kvantifikace proteinů Mgr. Stanislav Kukla Merck spol. s r. o. Agenda 1 Zhodnocení současných možností kvantifikace proteinů Bradfordové metoda

Více

Inovace studia molekulární a buněčné biologie

Inovace studia molekulární a buněčné biologie Inovace studia molekulární a buněčné biologie Tento projekt je spolufinancován Evropským sociálním fondem a státním rozpočtem České republiky. MBIO1/Molekulární biologie 1 Tento projekt je spolufinancován

Více

Evropský sociální fond Praha & EU: Investujeme do vaší budoucnosti ELEKTROMIGRAČNÍ METODY

Evropský sociální fond Praha & EU: Investujeme do vaší budoucnosti ELEKTROMIGRAČNÍ METODY Evropský sociální fond Praha & EU: Investujeme do vaší budoucnosti ELEKTROMIGRAČNÍ METODY ELEKTROFORÉZA K čemu to je? kritérium čistoty preparátu stanovení molekulové hmotnosti makromolekul stanovení izoelektrického

Více

PROTEOMIKA Pondělí 7/12. Label free kvantifikace SRM. Příprava vzorku pro shot-gun FASP. Proteomika membránových proteinů

PROTEOMIKA Pondělí 7/12. Label free kvantifikace SRM. Příprava vzorku pro shot-gun FASP. Proteomika membránových proteinů PROTEOMIKA 2015 Pondělí 7/12 Label free kvantifikace SRM Příprava vzorku pro shot-gun FASP Proteomika membránových proteinů Analýza proteinových komplexů shot-gun metody (pros and cons) až 10000 proteinů

Více

Název: Vypracovala: Datum: 7. 2. 2014. Zuzana Lacková

Název: Vypracovala: Datum: 7. 2. 2014. Zuzana Lacková Název: Vypracovala: Zuzana Lacková Datum: 7. 2. 2014 Reg.č.projektu: CZ.1.07/2.4.00/31.0023 Název projektu: Partnerská síť centra excelentního bionanotechnologického výzkumu MĚLI BYCHOM ZNÁT: informace,

Více

Jednotné pracovní postupy zkoušení krmiv STANOVENÍ OBSAHU MELAMINU A KYSELINY KYANUROVÉ METODOU LC-MS

Jednotné pracovní postupy zkoušení krmiv STANOVENÍ OBSAHU MELAMINU A KYSELINY KYANUROVÉ METODOU LC-MS Národní referenční laboratoř Strana 1 STANOVENÍ OBSAHU MELAMINU A KYSELINY KYANUROVÉ METODOU LC-MS 1 Rozsah a účel Postup je určen pro stanovení obsahu melaminu a kyseliny kyanurové v krmivech. 2 Princip

Více

Spektra 1 H NMR. Velmi zjednodušeně! Bohumil Dolenský

Spektra 1 H NMR. Velmi zjednodušeně! Bohumil Dolenský Spektra 1 MR Velmi zjednodušeně! Bohumil Dolenský Spektra 1 MR... Počet signálů C 17 18 2 O 2 MeO Počet signálů = počet neekvivalentních skupin OMe = informace o symetrii molekuly Spektrum 1 MR... Počet

Více

Praktický kurz Monitorování hladiny metalothioneinu po působení iontů těžkých kovů Vyhodnocení měření

Praktický kurz Monitorování hladiny metalothioneinu po působení iontů těžkých kovů Vyhodnocení měření Laboratoř Metalomiky a Nanotechnologií Praktický kurz Monitorování hladiny metalothioneinu po působení iontů těžkých kovů Vyhodnocení měření Vyučující: Ing. et Ing. David Hynek, Ph.D., Prof. Ing. René

Více

Techniky prvkové povrchové analýzy elemental analysis

Techniky prvkové povrchové analýzy elemental analysis Techniky prvkové povrchové analýzy elemental analysis (Foto)elektronová spektroskopie (pro chemickou analýzu) ESCA, XPS X-ray photoelectron spectroscopy (XPS) Any technique in which the sample is bombarded

Více

Magnetické částice pro detekci nádorových onemocnění, založené na protilátkách Vojtěch Adam

Magnetické částice pro detekci nádorových onemocnění, založené na protilátkách Vojtěch Adam Název: Školitel: Magnetické částice pro detekci nádorových onemocnění, založené na protilátkách Vojtěch Adam Datum: 7..203 Reg.č.projektu: CZ..07/2.4.00/3.0023 Název projektu: Partnerská síť centra excelentního

Více

Hmotnostní spektrometrie s průletovým analyzátorem a ionizací laserovou desorpcí v přítomnosti matrice (MALDI TOF MS)

Hmotnostní spektrometrie s průletovým analyzátorem a ionizací laserovou desorpcí v přítomnosti matrice (MALDI TOF MS) Hmotnostní spektrometrie s průletovým analyzátorem a ionizací laserovou desorpcí v přítomnosti matrice (MALDI TOF MS) MALDI TOF MS (z anglického Matrix-Assisted Laser Desorption/Ionization Timeof-Flight

Více

Chem. Listy 105, (2011)

Chem. Listy 105, (2011) KVANTIFIKACE PROTEINOVÝCH BIOMARKERŮ POMOCÍ HMOTNOSTNÍ SPEKTROMETRIE PRACUJÍCÍ V REŽIMU MONITOROVÁNÍ VYBRANÝCH REAKCÍ JAKUB FAKTOR a, IVA STRUHÁROVÁ a,b, ALENA FUČÍKOVÁ c, MARTIN HUBÁLEK c, BOŘIVOJ VOJTĚŠEK

Více

Základy interpretace hmotnostních spekter

Základy interpretace hmotnostních spekter Základy interpretace hmotnostních spekter Zpracováno podle: http://www.chem.arizona.edu/massspec/ - doporučený zdroj pro samostudium 1. Měříme četnost iontů pro dané hodnoty m/z 2. Vytvoříme grafickou

Více

Hemolyzační promývací roztok 60 H

Hemolyzační promývací roztok 60 H NÁVOD K POUŽITÍ Hemolyzační promývací roztok 60 H KATALOGOVÉ ČÍSLO P 113.01 POUŽITÍ Hemolyzační promývací roztok 60 H se používá jako hemolyzační roztok pro automatické analyzátory glykovaného hemoglobinu

Více

Proteinové znaky dětské leukémie identifikované pomocí genových expresních profilů

Proteinové znaky dětské leukémie identifikované pomocí genových expresních profilů Proteinové znaky dětské leukémie identifikované pomocí genových expresních profilů M.Vášková a spol. Klinika dětské hematologie a onkologie 2.LF UK a FN Motol Childhood Leukemia Investigation Prague Průtoková

Více

Možnosti proteomických metod v klinické diagnostice

Možnosti proteomických metod v klinické diagnostice Klin. Biochem. Metab., 20 (41), 2012, No. 3, p. 158 164. Možnosti proteomických metod v klinické diagnostice Vajrychová M. 1, Tambor V. 2, Lenčo J. 1 1 Ústav molekulární patologie, Fakulta vojenského zdravotnictví,

Více

SPECIFICATION FOR ALDER LED

SPECIFICATION FOR ALDER LED SPECIFICATION FOR ALDER LED MODEL:AS-D75xxyy-C2LZ-H1-E 1 / 13 Absolute Maximum Ratings (Ta = 25 C) Parameter Symbol Absolute maximum Rating Unit Peak Forward Current I FP 500 ma Forward Current(DC) IF

Více

Hmotnostní spektrometrie zdroj analytických informací

Hmotnostní spektrometrie zdroj analytických informací Klin. Biochem. Metab., 20 (41), 2012, No. 4, p. 210 215. Hmotnostní spektrometrie zdroj analytických informací Friedecký D. 1,2, Lemr K. 3 1 Laboratoř dědičných metabolických poruch, OKB, Fakultní nemocnice

Více

1. Metodika. Protokol č. F1-4 Metodika: Srovnávací analýza efektivity přípravy rekombinantního proteinu ve fermentoru

1. Metodika. Protokol č. F1-4 Metodika: Srovnávací analýza efektivity přípravy rekombinantního proteinu ve fermentoru Protokol č.: F1-4 Datum: 20.12.2010 Metodika: analýza efektivity přípravy výběr z výsledků ze zkušebních provozů výroby antigenů. Vypracoval: Ing. Václav Filištein, Mgr. Tereza Chrudimská, Spolupracující

Více

Iontové zdroje II. Iontový zdroj. Data. Vzorek. Hmotnostní analyzátor. Zdroj vakua. Iontové zdroje pracující za sníženého tlaku

Iontové zdroje II. Iontový zdroj. Data. Vzorek. Hmotnostní analyzátor. Zdroj vakua. Iontové zdroje pracující za sníženého tlaku MC230P43 Hmotnostní detekce v separačních metodách, 2015 Iontové zdroje II. Iontové zdroje pracující za sníženého tlaku Elektronová/chemická ionizace Iontové zdroje pro spojení s planárními separacemi

Více

Separační metody používané v proteomice

Separační metody používané v proteomice Separační metody používané v proteomice Proteome = komplexní směsi proteinů Lidská buňka 10,000 typů proteinů Rozdíl v koncentraci 10 6,plasma10 9 Nutnost separace, frakcionace Na úrovni Proteinů Obtížně

Více

Zdroje iont používané v hmotnostní spektrometrii. Miloslav Šanda

Zdroje iont používané v hmotnostní spektrometrii. Miloslav Šanda Zdroje iont používané v hmotnostní spektrometrii Miloslav Šanda Ionizace v MS Hmotnostní spektrometrie je fyzikáln chemická metoda, pi které se provádí separace iont podle jejich hmotnosti a náboje m/z

Více

STANOVENÍ ETHANOLU V ALKOHOLICKÉM NÁPOJI POMOCÍ NIR SPEKTROMETRIE

STANOVENÍ ETHANOLU V ALKOHOLICKÉM NÁPOJI POMOCÍ NIR SPEKTROMETRIE STANOVENÍ ETHANOLU V ALKOHOLICKÉM NÁPOJI POMOCÍ NIR SPEKTROMETRIE Úvod Infračervená spektrometrie v blízké oblasti (Near-Infrared Spectrometry NIR spectrometry) je metoda molekulové spektrometrie, která

Více

Analýza směsí, kvantitativní NMR spektroskopie a využití NMR spektroskopie ve forenzní analýze

Analýza směsí, kvantitativní NMR spektroskopie a využití NMR spektroskopie ve forenzní analýze Analýza směsí, kvantitativní NMR spektroskopie a využití NMR spektroskopie ve forenzní analýze Analýza směsí a kvantitativní NMR NMR spektrum čisté látky je lineární kombinací spekter jejích jednotlivých

Více

Hmotnostní spektrometrie

Hmotnostní spektrometrie Hmotnostní spektrometrie Podstatou hmotnostní spektrometrie je studium iontů v plynném stavu. Tato metoda v sobě zahrnuje tři hlavní části:! generování iontů sledovaných atomů nebo molekul! separace iontů

Více

Možná uplatnění proteomiky směrem do klinické praxe

Možná uplatnění proteomiky směrem do klinické praxe Možná uplatnění proteomiky směrem do klinické praxe Formy uplatnění proteomiky do klinické praxe Přímé uplatnění proteomických technologií Metody pro studium proteinů tu byly dřív něž proteomika jako obor

Více

Základy interpretace hmotnostních spekter měřených s použitím měkkých ionizačních technik

Základy interpretace hmotnostních spekter měřených s použitím měkkých ionizačních technik Základy interpretace hmotnostních spekter měřených s použitím měkkých ionizačních technik Pravidlo sudého počtu elektronů (Even-Electron Rule) 1/ E + EE + + R měkké ion.tech tech. 2/ EE + EE + + EI E +

Více

Vizualizace DNA ETHIDIUM BROMID. fluorescenční barva interkalační činidlo. do gelu do pufru barvení po elfu SYBR GREEN

Vizualizace DNA ETHIDIUM BROMID. fluorescenční barva interkalační činidlo. do gelu do pufru barvení po elfu SYBR GREEN ETHIDIUM BROMID fluorescenční barva interkalační činidlo do gelu do pufru barvení po elfu Vizualizace DNA SYBR GREEN Barvení proteinů Coommassie Brilliant Blue Coomassie Blue x barvení stříbrem Porovnání

Více

MOLEKULÁRNĚ BIOLOGICKÉ METODY V ENVIRONMENTÁLNÍ MIKROBIOLOGII. Martina Nováková, VŠCHT Praha

MOLEKULÁRNĚ BIOLOGICKÉ METODY V ENVIRONMENTÁLNÍ MIKROBIOLOGII. Martina Nováková, VŠCHT Praha MOLEKULÁRNĚ BIOLOGICKÉ METODY V ENVIRONMENTÁLNÍ MIKROBIOLOGII Martina Nováková, VŠCHT Praha MOLEKULÁRNÍ BIOLOGIE V BIOREMEDIACÍCH enumerace FISH průtoková cytometrie klonování produktů PCR sekvenování

Více

EFFECT OF CADMIUM ON TOBACCO CELL SUSPENSION BY-2

EFFECT OF CADMIUM ON TOBACCO CELL SUSPENSION BY-2 EFFECT OF CADMIUM ON TOBACCO CELL SUSPENSION BY-2 Štěpán Z., Klemš M., Zítka O., Havel L. Department of Plant Biology, Faculty of Agronomy, Mendel University in Brno, Zemědělská 1, 613 00 Brno, Czech Republic

Více

ZÁKLADNÍ EXPERIMENTÁLNÍ

ZÁKLADNÍ EXPERIMENTÁLNÍ Kurz praktické NMR spektroskopie 10. - 12. říjen 2011, Praha ZÁKLADNÍ EXPERIMENTÁLNÍ POSTUPY NMR ROZTOKŮ A KAPALIN Jana Svobodová Ústav Makromolekulární chemie AV ČR, v.v.i. Bruker 600 Avance III PŘÍSTROJOVÉ

Více

Imunochemické metody. na principu vazby antigenu a protilátky

Imunochemické metody. na principu vazby antigenu a protilátky Imunochemické metody na principu vazby antigenu a protilátky ANTIGEN (Ag) specifická látka (struktura) vyvolávající imunitní reakci a schopná vazby na protilátku PROTILÁTKA (Ab antibody) molekula bílkoviny

Více

FIA fluorescenční imunoanalýza (fluorescence immuno-assay) CIA chemiluminiscenční imunoanalýza

FIA fluorescenční imunoanalýza (fluorescence immuno-assay) CIA chemiluminiscenční imunoanalýza FIA a CIA FIA fluorescenční imunoanalýza (fluorescence immuno-assay) CIA chemiluminiscenční imunoanalýza Značky pro antigeny a protilátky: radioizotop enzym fluorescenční sonda luminiscenční sonda kovové

Více

Aminokyseliny, proteiny, enzymy Základy lékařské chemie a biochemie 2014/2015 Ing. Jarmila Krotká Metabolismus základní projev života látková přeměna souhrn veškerých dějů, které probíhají uvnitř organismu

Více

vzorek1 0.0033390 0.0047277 0.0062653 0.0077811 0.0090141... vzorek 30 0.0056775 0.0058778 0.0066916 0.0076192 0.0087291

vzorek1 0.0033390 0.0047277 0.0062653 0.0077811 0.0090141... vzorek 30 0.0056775 0.0058778 0.0066916 0.0076192 0.0087291 Vzorová úloha 4.16 Postup vícerozměrné kalibrace Postup vícerozměrné kalibrace ukážeme na úloze C4.10 Vícerozměrný kalibrační model kvality bezolovnatého benzinu. Dle následujících kroků na základě naměřených

Více

Program 14. ročníku Školy hmotnostní spektrometrie

Program 14. ročníku Školy hmotnostní spektrometrie Program 14. ročníku Školy hmotnostní spektrometrie 16. - 20. září 2013, Priessnitzovy léčebné lázně a.s., Jeseník Pondělí 16. 9. 2013 11:00-13:30 Příjezd účastníků, registrace, instalace stánků firem Zahájení

Více

3/7/2014. Dávkování vzorku LC/MS. Dávkování vzorku LC/MS

3/7/2014. Dávkování vzorku LC/MS. Dávkování vzorku LC/MS motnostní spektrometrie (3) Josef Chudoba LC/MS BSA - dávkování vzorku u LC/MS - PLC chromatografie chromatogram, základní pojmy režimy PLC, mobilní fáze, kolony (stacionární fáze) - elektrosprejová ionizace

Více

PLANÁRNÍ (PLOŠNÁ) CHROMATOGRAFIE

PLANÁRNÍ (PLOŠNÁ) CHROMATOGRAFIE PLANÁRNÍ (PLOŠNÁ) CHROMATOGRAFIE Tenkovrstvá chromatografie je technika pro identifikaci a separaci směsi organických látek Identifikace složek směsi (nutné použít standard) analysa frakcí sbíraných během

Více

Program 16. ročníku Školy hmotnostní spektrometrie aneb Naše spektrometrie. pořádané Spektroskopickou společností Jana Marka Marci

Program 16. ročníku Školy hmotnostní spektrometrie aneb Naše spektrometrie. pořádané Spektroskopickou společností Jana Marka Marci Program 16. ročníku Školy hmotnostní spektrometrie aneb Naše spektrometrie pořádané Spektroskopickou společností Jana Marka Marci Frymburk 13. 18. 9. 2015 Neděle 13. 9. 2015 11:00-14:00 Příjezd účastníků,

Více

Aplikace elektromigračních technik

Aplikace elektromigračních technik Aplikace elektromigračních technik Capillary electrophoresis D.L.Barker High Performance Capillary electrophoresis M.G. Khaledi Analysis and detection by capillary electrophoresis M.L.Marina (ed.) Electrophoresis

Více

Chromatofokusace. separace proteinů na základě jejich pi vysoké rozlišení. není potřeba připravovat ph gradient zaostřovací efekt jednoduchost

Chromatofokusace. separace proteinů na základě jejich pi vysoké rozlišení. není potřeba připravovat ph gradient zaostřovací efekt jednoduchost Chromatofokusace separace proteinů na základě jejich pi vysoké rozlišení není potřeba připravovat ph gradient zaostřovací efekt jednoduchost Polypufry - amfolyty Stacionární fáze Polybuffer 96 - ph 9-6

Více

HPLC/MS tělních tekutin nový rozměr v medicinální diagnostice

HPLC/MS tělních tekutin nový rozměr v medicinální diagnostice HPLC/MS tělních tekutin nový rozměr v medicinální diagnostice Lukáš Chytil Ústav organické technologie VŠCHT Praha Medicinální diagnostika a hmotnostní spektrometrie Medicinální diagnostika: - Klasické

Více

Základní principy interpretace spekter

Základní principy interpretace spekter Základní principy interpretace spekter Vyloučení iontů, které nesouvisí s analytem Určení molekulové hmotnosti Určení prvků přítomných v molekule Určení elementárního složení z přesné hmotnosti Hledání

Více

Chyby spektrometrických metod

Chyby spektrometrických metod Chyby spektrometrických metod Náhodné Soustavné Hrubé Správnost výsledku Přesnost výsledku Reprodukovatelnost Opakovatelnost Charakteristiky stanovení 1. Citlivost metody - směrnice kalibrační křivky 2.

Více

Máte rádi kuřata??? Jiří Hanika. Ústav chemických procesů AV ČR, v. v. i., Praha

Máte rádi kuřata??? Jiří Hanika. Ústav chemických procesů AV ČR, v. v. i., Praha Máte rádi kuřata??? Jiří Hanika Ústav chemických procesů AV ČR, v. v. i., Praha 1 Domácí chov? 2 Velkochov? 3 Budoucí rodinný oběd pro 4? 10 000 000 lidí si pochutná na více než 150 000 000 kuřat ročně!!!

Více

UNIVERZITA PARDUBICE FAKULTA CHEMICKO-TECHNOLOGICKÁ DISERTAČNÍ PRÁCE

UNIVERZITA PARDUBICE FAKULTA CHEMICKO-TECHNOLOGICKÁ DISERTAČNÍ PRÁCE UNIVERZITA PARDUBICE FAKULTA CHEMICKO-TECHNOLOGICKÁ DISERTAČNÍ PRÁCE 2009 Ing. David Kahoun UNIVERZITA PARDUBICE FAKULTA CHEMICKO-TECHNOLOGICKÁ ANALÝZA BIOLOGICKY AKTIVNÍCH LÁTEK V MEDOVINÁCH METODOU HPLC

Více

Hmotnostní analyzátory a detektory iont

Hmotnostní analyzátory a detektory iont Hmotnostní analyzátory a detektory iont Hmotnostní analyzátory Hmotnostní analyzátory Rozdlí ionty v prostoru nebo v ase podle jejich m/z Analyzátory Magnetický analyzátor (MAG) Elektrostatický analyzátor

Více

Ceník izolačních kitů STRATEC v mikrodestičkách

Ceník izolačních kitů STRATEC v mikrodestičkách Izolace plasmidové DNA ST7010300200 Invisorb Plasmid HTS 96 Kit for 2 x 96 preps 9 229 ST7010300300 isolation of pdna from up to 2.0 ml 4 x 96 preps 15 120 bacteria suspension in a 96-well format ST7010300400

Více

Průtokové metody (Kontinuální měření v proudu kapaliny)

Průtokové metody (Kontinuální měření v proudu kapaliny) Průtokové metody (Kontinuální měření v proudu kapaliny) 1. Přímé měření: analyzovaná kapalina většinou odvětvena + vhodný detektor 2. Kapalinová chromatografie (HPLC) Stanovení po předchozí separaci 3.

Více

Laboratorní analytické metody. Petr Tůma

Laboratorní analytické metody. Petr Tůma Laboratorní analytické metody Petr Tůma Rozdělení analytických metod Metody separační Chromatografie kapalinová plynová Elektroforéza Metody spektrální absorpční spektrometrie v UV/VIS Metody elektrochemické

Více

PROTEOMIKA V MOLEKULÁRNÍ TOXIKOLOGII: IDENTIFIKACE POTENCIÁLNÍCH ČASNÝCH PROTEI- NOVÝCH BIOMARKERŮ HEPATO- KARCINOGENITY U KRYS

PROTEOMIKA V MOLEKULÁRNÍ TOXIKOLOGII: IDENTIFIKACE POTENCIÁLNÍCH ČASNÝCH PROTEI- NOVÝCH BIOMARKERŮ HEPATO- KARCINOGENITY U KRYS PROTEOMIKA V MOLEKULÁRNÍ TOXIKOLOGII: IDENTIFIKACE POTENCIÁLNÍCH ČASNÝCH PROTEI- NOVÝCH BIOMARKERŮ HEPATO- KARCINOGENITY U KRYS KERSTIN FELLA a, MATTHIAS GLÜCKMANN b, VOLKER KRUFT b, PETER-JÜRGEN KRAMER

Více

AMINOKYSELINY STANOVENÍ AMINOKYSELINOVÉHO SLOŽENÍ BÍLKOVIN. Stanovení sirných aminokyselin. Obecná struktura

AMINOKYSELINY STANOVENÍ AMINOKYSELINOVÉHO SLOŽENÍ BÍLKOVIN. Stanovení sirných aminokyselin. Obecná struktura AMIKYSELIY becná struktura STAVEÍ AMIKYSELIVÉH SLŽEÍ BÍLKVI 1. IZLAE (jen v některých případech) 2. HYDLÝZA kyselá hydrolýza pomocí Hl ( c = 5 mol.dm -3 ) klasicky: 105-120, 18-24 h, inertní atmosféra,

Více

Stanovení asialotransferinu

Stanovení asialotransferinu Stanovení asialotransferinu v mozkomíšním moku metodou HPLC Pracovní den ČSKB Brno 10.11.2010 J. Gottwaldová, M. Dastych OKBH FN Brno Transferin transportní glykoprotein pro železo, váže 2 atomy Fe 3+

Více