Význam metalothioneinu v maligním potenciálu nádorových buněk Diplomová práce

Rozměr: px
Začít zobrazení ze stránky:

Download "Význam metalothioneinu v maligním potenciálu nádorových buněk Diplomová práce"


1 Mendelova univerzita v Brně Agronomická fakulta Ústav chemie a biochemie Význam metalothioneinu v maligním potenciálu nádorových buněk Diplomová práce Vedoucí práce: doc. RNDr. Vojtěch Adam, Ph.D. Vypracoval: Bc. Markéta Sztalmachová Brno 2013


3 Prohlášení Prohlašuji, že jsem diplomovou práci na téma Význam metalothioneinu v maligním potenciálu nádorových buněk vypracovala samostatně a použila jen pramenů, které cituji a uvádím v přiloženém seznamu literatury. Souhlasím, aby práce byla uložena v knihovně Mendelovy univerzity v Brně a byla zpřístupněna ke studijním účelům. V Brně dne... Podpis diplomanta...

4 Experimentální část této diplomové práce byla realizována na výzkumné infrastruktuře vybudované v rámci projektu CZ.1.05/2.1.00/ Centrum senzorických, informačních a komunikačních systémů (SIX) operačního programu Výzkum a vývoj pro inovace. Finanční podpora byla poskytnuta Evropským fondem pro regionální rozvoj a státním rozpočtem České republiky.

5 Poděkování Chtěla bych poděkovat doc. RNDr. Vojtěchu Adamovi, Ph.D., vedoucímu své diplomové práce. Velké díky patří především RNDr. Michalovi Masaříkovi, Ph.D, za odborné vedení a pomoc při vypracování této práce, dále MUDr. Jaromíru Gumulcovi, Mgr. Martině Raudenské, Ph.D. a všem dalším kolegům z ústavu patologické fyziologie LF MU, kde tato práce vznikla. Díky patří také Dr. Vladimíru Pekaříkovi, Ph.D., za přípravu plazmidu. Obrovské díky patří mému příteli Tomášovi za obrovskou trpělivost a podporu. Také bych ráda poděkovala své mamince a celé rodině, za to že mě vedli správným směrem. Tato práce byla podpořena projekty NanoBioMetalNet CZ.1.07/2.4.00/ a CEITEC CZ.1.05/1.1.00/

6 Abstrakt Cílem této práce byla především analýza MT a ověření jeho vlivu v patogenezi nádorových onemocnění. Práce je zaměřena na nádorová onemocnění prsu a prostaty a roli metalothioneinu (MT) v jejich patogenezi. Experimenty byly prováděny na buněčných liniích (PNT1A, PC-3, 4T1, 4T1 se zvýšenou expresí MT), ale také na zvířecím experimentálním modelu (myši kmene Balb/c). Analýza byla provedena jak na úrovni expresí genů MT1 a MT2, tak na proteinové úrovni. U zvířecích modelů byla navíc provedena analýza exprese genů p53 a MTF-1. Bylo využito MTT testů, systému xcelligence RTCA DP a real-time PCR. Z výsledků vyplývá, že exprese genů MT1, MT2, p53 a MTF-1 i hladina MT1 a MT2 na proteinové úrovni je ovlivněna typem tkáně. V jaterní tkáni u zvířat s indukovaným nádorem a suplementovaných zinkem je zvýšená exprese MT1 a MT2 genů. Byl prokázán vliv suplementace zinku na velikost nádorů. Klíčová slova Metalothionein, buněčné kultury, Balb/c myši, zinek, karcinomy prsu, metastázy Abstract The aim of this work was mainly MT analysis and verification of its influence in the pathogenesis of cancer. I focused on breast cancer and prostate cancer and the role of metallothionein (MT) in their pathogenesis. Experiments were performed on cell lines (PNT1A, PC-3, 4T1, 4T1 overexpressing MT), but also in an animal experimental model (mice Balb / c). Analysis was performed at the level of gene expression of MT1 and MT2, and at the protein level. In animal models were also analyzed gene expression of p53 and MTF-first We used MTT assays, the xcelligence RTCA DP and real-time PCR. The results show that the expression of genes MT1, MT2, p53 and MTF-1 and the level of MT1 and MT2 at the protein level is affected by the type of tissue. In liver tissue in animals with induced tumors and supplemented with zinc is overexpression MT1 and MT2 gene. The effect of the supplementation of zinc on tumor size has been shown. Keywords Metallothionein, Cell lines, Balb/c mouse, zinc, breast cancer, metastasis

7 Obsah 1 Úvod Literární přehled Metalothionein (MT) Struktura metalothioneinu Izoformy metalothioneinu Biologické funkce metalothioneinu Genová exprese a syntéza metalothioneinu Metabolizmus těžkých kovů a MT Role metalothioneinů v karcinogenezi Nádorová onemocnění prsu Biomarkery používané v diagnostice karcinomu prsu Mutace supresorových genů BRCA1, BRCA2 a p Prediktivní faktory léčebné odpovědi Metalothionein jako nový biomarker v diagnostice karcinomu prsu? Cíle práce Materiál a metodika Materiál Chemikálie Přístrojové vybavení Plazmid Metody Buněčné kultivace MTT Real-time monitoring pomocí systému xcelligence RTCA DP Transfekce prsní linie 4T Buněčná invazivita a migrace s použitím systému xcelligence RTCA DP Izolace RNA z buněk a reverzní transkripce Kvantitativní polymerázová řetězová reakce (q-pcr)- cdna z buněk Pokusná zvířata Aplikace nádorových buněk 4T1 zvířatům Sledování růstu nádoru a ukončení experimentu... 31

8 Izolace RNA z tkání a reverzní transkripce Kvantitativní polymerázová řetězová reakce (q-pcr)- cdna z tkání Příprava buněčných lyzátů Stanovení proteinů Stanovení MT pomocí Dot Blotu Statistická analýza Výsledky Výsledky MTT testů Real-time monitoring pomocí xcelligence systému Invazivita a migrace buněčných linií Stanovení exprese MT1 amt2 z buněčných lyzátů Stanovení exprese MT1, MT2, MTF-1, p53 z tkáňových lyzátů Stanovení MT z tkáňových lyzátů na proteinové úrovni Zobecnění efektu suplementace zinkem a indukce tumoru na všechny tkáně Vliv suplementace zinkem, typu tkáně a indukce nádoru Diskuze Závěr Přehled použité literatury Seznam obrázků Seznam tabulek Přílohy... 68

9 Seznam zkratek MT metalothionein AMK aminokyselina GSH redukovaný glutathion GSSG oxidovaný glutathion ATP adenozintrifosfát GTP guanozintrifosfát ROS reaktivní formy kyslíku (reactive oxygen species) DNA/RNA deoxyribonukleová/ribonukleová kyselina mrna mediátorová ribonukleová kyselina MTF-1 metal regulační transkripční faktor MRE metal responzivní element GIF růstový inhibiční faktor (growth-inhibitory factor) CA 15-3 nádorový antigen (cancer antigen 15-3) CEA karcinoemryonální antigen (carcinoembryonic antigen) ER estrogenový receptor PR progesteronový receptor HER2 lidský receptor epidermálního růstového faktoru 2 (human epidermal growth factor receptor 2)

10 1 ÚVOD Co stojí za vznikem nádorového onemocnění? Dá se mu účinně předcházet? Pokud už se tato nemoc objeví, jakou léčbu zvolit a jakou má člověk šanci, že léčba u něj bude účinná? Existuje mnoho nezodpovězených otázek na toto téma. Je jasné, že se ve většině případů nejedná o onemocnění vyvolané jediným faktorem, ale jedná se o multifaktoriální onemocnění. Není proto divu, že se dnes výzkumem na toto téma zabývá mnoho pracovišť. Těžko říci, zda se této chorobě dá předcházet, ale je důležité najít účinnou léčbu. V případě, že již u člověka rakovina propuknula, je velice důležité diagnostikovat tuto nemoc včas. Tímto problémem se dnes zabývá velké množství vědeckých pracovišť a mnoho z nich se zaměřilo na hledání markerů, které na nemoc upozorní. V praxi se již některé z těchto markerů používají, ale i přesto se stále nedaří boj s touto nemocí vyhrát. Z markerů, které se již zavedly do praxe, bych mohla zmínit prostatický specifický antigen (PSA), který se využívá v diagnostice karcinomu prostaty. U karcinomů prsu se jako prognostické markery používají estrogenový receptor, progesteronový receptor či HER2 receptor. U karcinomu prsu hraje ve vzniku tohoto onemocnění velkou roli také genetika, a proto se do praxe zavedlo genetické testování genů BRCA1 a BRCA2. Ženy s mutací v tomto genu mají zvýšené riziko vzniku této nemoci. Toto testování je také jednou z možností jak preventivně předcházet vzniku karcinomu prsu. V této diplomové práci se zabývám metalothioneinem, jakožto potenciálním markerem v karcinogenezi. 9

11 2 LITERÁRNÍ PŘEHLED 2.1 Metalothionein (MT) Metalothioneiny (MT) jsou nízkomolekulární intracelulární proteiny bohaté na cystein, jejichž hmotnost se pohybuje v rozmezí 6-10 kda. [28, 31, 59, 80, 101] Cystein zaujímá až 30 % hmotnosti molekuly. [59, 91, 96, 97] Díky thiolovým skupinám cysteinu tvoří metalothionein vazby s atomy kovů, proto má důležitou roli v přenosu těžkých kovů a jejich detoxikaci. [2, 24, 28, 58, 60, 64, 91] MTs jsou termostabilní proteiny [16, 94] a obvykle se nachází v intracelulárním prostředí, ale můžeme je nalézt také v krvi, plazmě či mozkomíšním moku. [13] Nejvyšší koncentrace MT v těle jsou v játrech, ledvinách, střevech a slinivce břišní. [22] MT byl poprvé popsán v roce 1957, kdy ho při hledání látek zodpovědných za akumulaci dvojmocných kovů v buňkách ledvin izolovali M. Margoshes a B. L. Vallee. [65] Následně byl identifikován téměř ve všech organizmech, a to jak u bakterií, rostlin, bezobratlých, tak i u obratlovců. [63, 80, 91] Díky zvýšené akumulaci MT v organizmu, který byl vystaven působení těžkých kovů, je MT používán jako biomarker při sledování znečištění životního prostředí. [76, 81, 103] Struktura metalothioneinu Molekula MT je složena ze dvou domén, značených jako α a β domény. [30, 32, 59, 60, 95] β-doména obsahuje devět cysteinových zbytků a má tři vazebná místa. α-doména má 11 cysteinových zbytků a je schopna vázat 4 dvojmocné ionty (Obrázek č. 1). [33, 91, 95] Jedna molekula MT může navázat až 12 monovalentních iontů nebo 7 dvojmocných iontů kovů. Afinita k jednotlivým kovům klesá v pořadí Hg-Ag-Cu-Cd-Zn. [22, 59, 60] MT se obvykle vyskytuje v komplexu se zinkem či mědi (ZnMT a CuMT) nebo jako smíšená forma několika kovů (např. Zn, CuMT). U savců je dominantní především ZnMT forma. [91] Tento termostabilní protein je složen z aminokyselin (AMK), 20 z nich jsou cysteiny a nenajdeme zde žádnou aromatickou aminokyselinu či histidin. [22, 33, 82, 95] Koordinace kovových iontů pak určuje trojrozměrnou strukturu. [16] Jako apo-mt je označována molekula, která neobsahuje kovy. [16] Je charakteristická šestkrát opakující se repeticí C-X-C (C značí cystein, X může být libovolná AMK) a jednou odlišnou sekvencí K-X(1,2)-C-C-X-C-C-P-X(2)-C. [28, 82] 10

12 Obrázek 1: Struktura metalothioneinu MT složený ze dvou domén (α-doména a β-doména). Tečkovaně jsou naznačeny vazby mezi cysteiny obsahující SH skupiny (žlutě) a kovem (zeleně). Převzato z [cit ] Izoformy metalothioneinu Metalothionein má čtyři izoformy: MT1 až MT4 (Obrázek č. 2). Zatímco izoformy 1 a 2 se vyskytují v řadě tkání a dominantně vážou kovy, izoformy 3 a 4 se vyznačují buněčnou specifičností. [25, 38, 91, 95] Izoformy MT1 a MT2 se nachází především v játrech, slinivce, střevech a ledvinách. [6] Izoforma MT3, též nazývaná jako neuronový růstový inhibiční faktor (GIF- growth-inhibitory factor), se vyskytuje především v mozkové tkáni [69] a byla pozorována i v glomerulech ledvin. [25] Podílí se na vzniku, ale také na průběhu apoptózy mozkových buněk. [94] MT4 se nachází v epitelech a to hlavně v ústní dutině, horní části gastrointestinálního traktu a v kůži. [57, 82, 91, 99] Zapojuje se do regulace žaludečního ph a také chrání kůži před spálením a jinými kožními traumaty. [94] 11

13 Obrázek 2: Izoformy metalothioneinu a jejich lokalizace v savčím organismu. Upraveno dle [24] Exprese MT1 a MT2 může být vyvolána mnoha faktory, jako jsou kovy, glukokortikoidy, cytokiny či oxidační stres. Exprese MT3 a MT4 je přísně tkáňově specificky regulována. [91] I přes různorodost výskytu jednotlivých izoforem v tkáních jsou mezi nimi patrné sekvenční shody, jako například vysoký podíl cysteinu (obrázek č. 3). [80] Izoformy MT1 a MT2 mají roli převážně v detoxikaci kovů, zatímco MT3 se podílí na udržování homeostázy zinku v neuronech. [28, 70, 82] Exprese genů MT1 a MT2 v orgánech může být mimo jiné ovlivněna pohlavím a věkem. [82] U dospělých savců byly MT1 a MT2 lokalizovány převážně v cytoplazmě, ale i v lysozomech, mitochondriích a v jádrech. Tyto dvě izoformy se vyskytují nejčastěji a byly rozsáhle studovány zejména ve vztahu k jejich roli v homeostáze kovů a detoxikaci. [38, 82] U lidí bylo detekováno osm funkčních (MT1A, MT1B, MT1E, MT1F, MT1G, MT1H, MT1X a MT2A) a sedm nefunkčních (MT1C, MT1D, MT1I, MT1J, MT1K, MT1L a MT2B) izoforem MT1 a MT2. [36, 62]. 12

14 MT1 MDPN-CSCSTGGSCTCTSSCACKNCKCTSCKKSCCSCCPVGCSKCAQGCVCKG...AADKCTCCA 61 MT2 MDPN-CSCASDGSCSCAGACKCKQCKCTSCKKSCCSCCPVGCAKCSQGCICKE.ASDKCSCCA 61 MT3 MDPETCPCPTGGSCTCSDKCKCKGCKCTNCKKSCCSCCPAGCEKCAKDCVCKGEEGAKAEAEKCSCCQ 68 MT4 MDPGECTCMSGGICICGDNCKCTTCSCKTCRKSCCPCCPPGCAKCARGCICKG.GSDKCSCCP 62 Obrázek 3: Porovnání sekvencí AMK izoforem MT1 až MT4 u myši. Na konci sekvence je uveden počet AMK v daném proteinu. Červeně je vyznačen cystein. Upraveno dle [34] Biologické funkce metalothioneinu Metalothionein je považován za víceúčelový protein. [13, 16] Jedna z nejdůležitějších funkcí MT je detoxikace kovů, udržování jejich hladiny v buňkách (zachycení, skladování, distribuce a vyloučení kovu) a také ochrana před buněčným stresem. [9, 40, 76, 80, 83, 91, 99] MT má vysokou afinitu k zinku a je tedy silným akceptorem zinečnatých iontů, které do buňky vstupují z extracelulárního prostředí přes cytoplazmatickou membránu, z lysozomů po degradaci molekul obsahujících zinek nebo po vyloučení Zn 2+ z jiných vnitrobuněčných struktur. Zinek má zásadní význam pro zachování zdraví a je nezbytný pro fungování řady enzymů a transkripčních faktorů. [15, 38, 55, 99] Pět až dvacet procent zinku nacházejícího se v buňce je asociováno s MT. Díky tomuto vychytávání je intracelulární koncentrace volného zinku nízká. [90, 91] Význam MT je stále zřetelnější především ve schopnosti udržovat homeostázu. [9, 69] Mnoho studií poukazuje na to, že MT je jeden z hlavních proteinů vázajících zinek. [99] I přes vysokou stabilitu komplexu ZnMT mohou být zinečnaté ionty uvolněny z molekuly a vznikne apo-mt a naopak, kdy se zinek naváže na apo-mt za vzniku molekuly ZnMT. Toto je možno sledovat u redoxních reakcí prostřednictvím redukovaného (GSH) a oxidovaného glutathionu (GSSG), které jsou katalyzovány proteiny obsahujícími selen. GSSG oxiduje ZnMT, dochází ke zvýšenému uvolňování Zn 2+ z molekuly a ke vzniku apo-mt. Tato forma MT může být degradována nebo použita v prostředí s vysokým obsahem GSH s pomocí selenu jako katalyzátoru. Pokud převládá GSH, váže se s MT a snižuje uvolňování zinečnatých iontů z molekuly. MT může být rychle regenerován s rostoucí koncentrací zinečnatých iontů (obrázek č. 4). [16, 23] Zatímco zvýšená koncentrace GSH snižuje koncentraci volného Zn 2+, ROS a GSSG zvyšují uvolňování zinku ze ZnMT a jeho přenos do různých jaderných proteinů, které mají antioxidační působení. [82] Ve výše uvedených mechanizmech je redoxní stav jedním z hlavních regulátorů výměny Zn 2+ mezi MT a dalšími intracelulárními molekulami. 13

15 [97] Extracelulární MT s navázaným kovem může být internalizován endocytózou následně vstupuje do lysozomů. V lysozomech je kov uvolněn a apo-mt je hydrolyzován. [82] Obrázek 4: Zapojení MT v redoxním cyklu. Při zvýšené koncentraci Zn2+ dochází k jejich navázání na molekulu apo-mt. V oxidačním prostředí jsou zinečnaté ionty uvolňovány z molekuly MT a využity proteiny, jako jsou transkripční faktory či metaloenzymy. Oxidovaná forma apo-mt ox může podlehnout degradaci nebo může být využita v redukčním prostředí s pomocí selenu jako katalyzátoru. MT se následně regeneruje při zvýšení koncentrace Zn 2+. Upraveno dle [23] Metalothionein, který váže zinek či měď je důležitým úložištěm těchto kovů, které jsou kofaktory enzymů a jsou nezbytně důležité pro růst buněk. [74, 93] V případě potřeby jsou z MT uvolněny a použity pro syntézu apoenzymů [1, 28, 91]. Poskytování zinku a mědi je zásadní pro buněčnou proliferaci, diferenciaci a vývoj v prenatálním i perinatálním období. [54, 71] Zinek se významně podílí na imunitních reakcích, v signalizačních drahách, rakovině a stárnutí, a změny v jeho hladinách byly pozorovány také při nervových onemocněních. [44] Díky vlivům na hospodaření s kovy může tedy MT působit jako významné neuroprotektivum. [13] Uvádí se, že MT se podílí i na regeneraci po částečném odstranění orgánu, ochraně před neurodegenerativními onemocněními, ale v některých případech byly pozorovány též genotoxické a karcinogenní účinky MT. [28, 55, 82]. Kromě funkce uvolňování zinku z molekuly má MT i silné antioxidační vlastnosti, a to díky vysokému obsahu thiolových skupin, které z něj činí molekulu ideální pro interakci s reaktivními formami kyslíku (ROS). [51, 91] MT odstraňuje volné radikály vzniklé při běžném metabolizmu či oxidačním stresem, snižuje jejich účinek 14

16 v cytoplazmě a je považován za stresový biomarker. [76] Dále se váže s GSH, který bojuje proti produkci volných radikálů v cytoplazmě. [60, 93] Metalothionein se též podílí na translokaci zinku do mitochondrií a jádra. [2, 58, 60, 70, 82] V mitochondriích byl MT detekován v mezimembránovém prostoru a předpokládá se, že sem vstupuje z cytoplazmy ve formě ZnMT přes vnější mitochondriální membránu. Mechanizmus zůstává prozatím neznámý. V závislosti na přítomnosti zinku v mitochondriích reguluje ZnMT aktivitu zinek-dependentních metaloenzymů a reguluje rychlost dýchání. [20] Rychlost uvolňování zinku z ZnMT může být podpořena a posílena vazbou ATP či GTP k metaloproteinu. Kovy rychle se hromadící v mitochondrii, případně i přes Ca 2+ uniport ve vnitřní mitochondriální membráně, se váží na proteiny přenášející elektrony a zablokují oxidační fosforylaci, což má za následek nadprodukci ROS. Velká produkce ROS snižuje vazbu kovů na MT, jeho redoxní funkce a narušuje tvorbu ATP. Nadprodukce ROS může aktivovat mitochondriální proteiny zprostředkovávající signalizační kaskádu vedoucí buňky k apoptóze nebo nekróze. [82] V jádře je zinek potřebný pro normální funkci histonů a nehistonových proteinů, metaloenzymů (RNA a DNA polymerázy), transkripčních faktorů, zvláště pak pro zink-finger proteiny, které regulují aktivitu jednotlivých genů. MT zde představuje hlavní donor zinku. Bylo zjištěno, že v játrech dospělých zvířat a lidí je na rozdíl od plodu či novorozence velmi nízký obsah jaderného MT. U rostoucích zvířat byl rovněž nalezen vysoký obsah MT v jádrech, což odráží zvýšenou potřebu zinku v rychle rostoucích buňkách či v reparačních procesech. [47] Jaderný MT pochází z cytozolu, ale přesný mechanizmus jeho přesunu do jádra není zatím znám. Díky své malé velikost může MT procházet jadernými póry, ale molekula nacházející se v cytoplazmě musí být aktivována zatím neidentifikovaným cytozolovým faktorem. V aktivaci by mohly hrát roli malé G-proteiny a perinukleární cytoskelet. [20] Následně může být molekula MT přepravována a uchovávána v jádře. Podnětem pro translokaci MT může být obecně redoxní stav v buňce. Transport do jádra je posílen při oxidačním stresu souvisejícím se zvýšenou produkcí ROS. [82] V poslední době se ukazuje, že zvýšená exprese MT v buňkách indukuje antiapoptotické účinky. [16, 86, 99] S antiapoptotickým účinkem souvisí aktivace transkripčního jaderného faktoru (NF-kB), který může být aktivován různými podněty (tumor nekrotizující faktor, interleukin 1, hypoxie či ROS). Molekula NF-kB vyskytující se v cytoplazmě se skládá z podjednotek p50 a p65 a dále z inhibiční podjednotky. Pouze 15

17 doména p65 obsahuje transaktivační doménu, která aktivuje transkripci genů. [96, 97] Aktivace NF-kB je uskutečněna disociací její molekuly, degradací inhibiční podjednotky a následně translokaci NF-kB z cytoplazmy do jádra, kde se váže na DNA a indukuje transkripci řady genů zapojených do buněčné transformace, proliferace a angiogeneze. Zajímavé je, že tyto podněty aktivují zároveň MT, který zajišťuje stabilizaci NF-kB na DNA (obrázek č. 5). [52, 99] V souvislosti s aktivací NF-kB v procesu karcinogeneze se jako karcinogeny a nádorové promotery uvádějí toxické kovy, UV záření, azbest, benzopyren, ROS a další. V některých studiích byla zdokumentována aktivace NF-kB v nádorových buňkách. Aktivace NF-kB byla následována proliferací těchto buněk. [96, 97] Obrázek 5: Antiapoptotická role MT zprostředkovaná interakcí s NF-kB: NF-kB je složena ze dvou podjednotek P50 a P65, které jsou v cytoplazmě asociovány s inhibiční podjednotkou I-kB. Oxidací jsou aktivovány proteinkinázy a dochází k odštěpení inhibiční podjednotky I-kB od NF-kB. Inhibiční podjednotka je následně fosforylována a degradována. Disociační komplex NF-kB nyní může být translokován do jádra, kde se váže na DNA a aktivuje transkripci řady genů. MT zde působí jako stabilizátor vazby NF-kB na DNA. Upraveno dle [99] Genová exprese a syntéza metalothioneinu V savčím genomu se nachází více genů pro MT, které ho kódují. U hlodavců je MT řízen čtyřmi geny nacházející se na chromozomu 8 (MT1 až MT4). Lidský MT je kódován 17 geny, které se nachází na chromozomu 16. [9, 22, 29, 56] Z nichž 13 genů kóduje izoformu MT1, 2 geny izoformu MT2, jeden gen je určen pro izoformu MT3 a jeden 16

18 pro MT4. [69] U těchto genů byl zjištěn výrazný polymorfizmus a každá forma má také více izoforem, které se mohou vyskytovat v různých částech tkání. [16, 82, 95] Jejich přesné fyziologické role a funkční charakteristiky jsou zatím nejasné. V regulaci genové exprese MT má klíčovou roli metal regulační transkripční faktor (MTF-1), který aktivuje transkripci MT v reakci na přítomnost kovů či oxidační stres (obrázek č. 6). [92, 97, 99, 101] Za normálních okolností se MTF-1 v buňce nachází v inaktivním stavu s navázaným MTI, což je inhibitor bránící navázání MTF-1 na MRE. [42, 91] MRE je sekvence DNA nutná pro navázání MTF-1 a následné spuštění transkripce a nachází se v několika kopiích v promotoru všech genů pro MT. [38, 54, 62, 101] Po vstupu iontu kovu do buňky se tento iont naváže na MTI a uvolní se tím MTF-1, který může zahájit transkripci MT. Vzrůstající koncentrace těžkých kovů tak může indukovat syntézu MT. [39, 42] MTF-1 je kovy vázající protein složený z šesti zinkových prstů a vyskytuje se u mnoha živočišných druhů od hmyzu až po savce. [29, 74] Transkripční faktory, které jsou ovlivňovány kovovými ionty a regulují expresi genů, patří mezi metal-regulační proteiny. Metal-regulační proteiny mohou regulovat transkripci nebo stabilitu mrna a následnou translaci. [38] Obrázek 6: Schéma regulace genové exprese MT. Vstup zinečnatých iontů do buňky je zajištěn pomocí zinkového transportéru ZIP-1. MTF-1 aktivován zinečnatými ionty se váže na MRE v promotoru a spouští transkripci apo-mt. Volné zinečnaté ionty se poté vážou na molekulu apo-mt za vzniku komplexu ZnMT. Upraveno dle [22] 17

19 Biosyntéza MT je řízená několika faktory. Zvýšená syntéza MT je pozorována v reakci na poranění tkání, při infekci, zánětech či nádorových onemocněních. [22] Jedním z hlavních faktorů je indukce syntézy kovy. [81, 92, 95] Při zvýšeném příjmu zinku či mědi se zvýší syntéza MT, především v játrech a ve střevech, což je jeden z přímých mechanismů detoxikace těžkých kovů. Carey a kol. [17] zjistili, že syntéza MT je indukována také při reakci na lipopolysacharidy, které jsou uvolněny při potratech a také při působení teratogenních faktorů. Metabolizmus MT je velice citlivý na hormonální regulaci realizovanou prostřednictvím glukokortikoidů, katecholaminů, glukagonu, steroidů, interleukinu-6, angiotensinu-2 a různých stresových faktorů. [37, 92, 95] Syntéza MT je zvýšená u rychle proliferující tkáně, což má důležitou roli u normálních, ale i u nádorových buněk. Zvýšená koncentrace MT u proliferujících buněk je přičítána vyšší hladině zinku a mědi a byla zaznamenána u různých nádorových onemocnění. [28, 71] Některé studie ukazují zvýšenou syntézu MT1 a MT2 u proliferujících a diferencujících se buněk oproti buňkám nedělícím se. Za těchto podmínek byla zvýšená hladina MT jak na úrovni mrna, tak na proteinové úrovni. [71, 87, 89, 99] Z těchto výsledků bylo navrženo, že MT buňku chrání před vysokou dávkou zinku vznikem ZnMT. [90] Metalothionein může být poměrně rychle degradován, přičemž hlavním místem odbouráváním jsou lysozomy. [95] Absence MT není smrtelná ani nijak škodlivá v případech, kdy není organizmus vystaven nadměrnému působení kovů. V případě absence MT je pozorována snížená tolerance ke kovům, vyšší citlivost k oxidačnímu stresu, náchylnost k zánětlivým procesům či infekcím. [16] Metabolizmus těžkých kovů a MT Těžké kovy se do organizmu dostávají absorpcí kůží, inhalací či ingescí. Vdechnutá látka, která se nerozpustí v mukózních hlenech přechází do alveol a následně se dostává do krve. Při ingesci toxicitu kovu ovlivňuje jeho forma, rychlost průchodu trávicím traktem a množství proteinů, jako jsou právě metalothioneiny. V obou těchto případech se uplatňují mechanizmy difúze či aktivního transportu vazbou na specifické bílkoviny. [1] Detoxikace kovů probíhá převážně v játrech a ledvinách, ovšem ke kumulaci kovů dochází i v mozku a kostech. Těžké kovy navázané na MT jsou tedy transportovány do ledvin a jater a následně vyloučeny močí a stolicí. [46, 84, 92, 100] Schéma metabolizmu těžkých kovů a zapojení MT v něm je uvedeno na obrázku č

20 Obrázek 7: Metabolizmus těžkých kovů. Těžké kovy se do organizmu dostávají inhalací, absorpcí nebo ingescí a dále se dostávají do krevního oběhu. Krví se šíří do jater či ledvin a následně jsou vyloučeny v komplexu s MT. Upraveno dle [67] Role metalothioneinů v karcinogenezi V posledních letech je MT zkoumán jako možný diagnostický marker progrese nádorů. Některé studie ukazují na zvýšenou hladinu MT v séru pacientů s karcinomem prsu, plic, trávícího systému, melanomu či urogenitálního traktu. [37, 40] Mezi expresí MT u jednotlivých typů nádorů existují rozdíly, což je projevem fenotypové rozmanitosti MT. [37] Obecně je zvýšená hladina MT spojena s horší prognózou. [6, 47] Zdá se, že MT může chránit nádorové buňky před apoptózou a zvyšovat tak odolnost nádorových buněk vůči radioterapii a chemoterapii. [13, 37, 86] Předpokládá se, že léky používané při nádorové terapii či jejich metabolity interagují s MT, čímž je inhibována přímá interakce léků s jejich cílem a snížená účinnost terapie. [47, 93, 98] MT také slouží jako dárce zinku pro transkripční faktory a může tak podporovat nádorovou buněčnou proliferaci či metastázování. [47] Na druhé straně některé studie zabývající se například karcinomem tlustého střeva nebo močového měchýře nepotvrdily významnou korelaci mezi expresí MT a karcinomy. [48, 73] Použití MT jako potenciálního markeru nádorové diferenciace a proliferace je ve stádium intenzivního výzkumu. [28] Biomedicínské aspekty MT byly zkoumány v onkologických studiích v souvislosti s cisplatinou, jakožto chemoterapeutikem. [27] Cisplatina je jedním z nejsilnějších protinádorových léků a je účinná u velké škály nádorů. Používá se také v kombinaci s radioterapií nebo spolu s chirurgickou léčbou. [53] Cytotoxické účinky cisplatiny jsou dány její vazbou na jadernou DNA. Narušením struktury DNA způsobí inhibici tran- 19

21 skripce a oprav jejího poškození [53] a také způsobuje okamžitou indukci syntézy MT. [16] 2.2 Nádorová onemocnění prsu Karcinom prsu je nejčastějším nádorovým onemocněním vyskytujícím se u žen a představuje 23 % z celkového počtu výskytu nádorových onemocnění. [49] I přes zvýšený výskyt se díky lepší terapii povedlo za posledních dvacet let snížit úmrtnost. [43] Karcinom prsu je komplexní genetické onemocnění charakterizované nahromaděním několika molekulárních změn. [79] Mezi faktory, které přispívají k rozvoji karcinomu prsu, patří postmenopauzální hormonální terapie, užívání perorální antikoncepce, pozdní věk při prvním porodu, konzumace alkoholu či obezita, ale také genetické či vrozené faktory. [3, 49, 75] Riziko vzniku karcinomu prsu roste v případě, pokud má žena blízkou příbuznou s tímto onemocněním nebo také pokud má více než jednoho vzdáleného příbuzného s tímto onemocněním. [68] K základním vyšetřovacím technikám patří mamografické vyšetření prsu, které se používá jako screeningová metoda. [14] V České republice se dle vyhlášky Ministerstva zdravotnictví ČR č. 3/2010 Sb. o stanovení obsahu a časového rozmezí preventivních prohlídek provádí mamografické vyšetření u žen od 45 let věku ve dvouletých intervalech. Nicméně senzitivita mamografie se pohybuje v rozmezí 63 až 87 % a dochází k falešným negativitám. Je tedy na místě doplnit mamografické vyšetření například stanovením biomarkerů pro daný typ karcinomu. Každopádně je v dnešní době mamografie stále nejúčinnějším nástrojem pro časnou detekci karcinomu prsu. [61] Biomarkery používané v diagnostice karcinomu prsu Vyšetření biomarkerů je neinvazivní metoda a může omezit množství žen, které musejí podstoupit zbytečné bioptické vyšetření. Vyšetření nádorových markerů se v hojné míře používá při kontrole pacientů po léčbě, a tímto způsobem je možno včas rozeznat více než 50 % případů recidiv. [4] K rutinnímu vyšetření na přítomnost karcinomu prsu se dnes ve většině diagnostických center používá několik biomarkerů. Prvním markerem používaným v diagnostice karcinomu prsu byl Cancer antigen 15-3 (CA 15-3). Jedná se o cirkulující mucinový glykoprotein, jehož hladina v krvi se u zdravých jedinců pohybuje pod 30 U/ml. Senzitivita tohoto markeru dosahuje %. [4] Dalším používaným markerem je karcinoembryonální antigen (CEA). Tento marker se používá i u ji- 20

22 ných typů nádorových onemocnění, přičemž u karcinomu prsu se jeho senzitivita pohybuje kolem 54 %. Používá se tedy společně s CA 15-3 jako marker druhé řady. U zdravých lidí se jeho hodnota v krvi pohybuje v koncentraci do 3 ng/ml. [4] CEA se vyskytuje ve % případů s přítomností vzdálených metastáz, zatímco CA 15-3 je zvýšen především v případě lokálních karcinomů. [3] Mutace supresorových genů BRCA1, BRCA2 a p53 U žen s významnou rodinnou anamnézou nádorového onemocnění prsu se používá genetické testování pro mutace v tumor supresorovém genu BRCA1 (breast cancer 1) nebo BRCA2 (breast cancer 2). [68] Gen BRCA1 je lokalizován na 17. chromozomu a je zapojen do řízení a kontroly buněčného cyklu a reparace poškozené DNA. Gen BRCA2 se nachází na 13. chromozomu a je zapojen do procesu homologní rekombinace. [72] Pacientky, u kterých byla zjištěna některá z těchto mutací, mají až devadesátinásobně zvýšené riziko vzniku karcinomu prsu. [3] Nositelem BRCA mutace je přibližně 25 % pacientek a i přes negativní výsledek mutačního testu může toto onemocnění propuknout. U nositelek těchto mutací se doporučuje běžné mamografické vyšetření, ale také preventivní odstranění prsu a chemoprevence. [85] Gen p53 je klíčový faktor v buněčné odezvě na poškození DNA a jeho mutací může dojít k rozvoji nádorových onemocnění. [45] Mutace genu p53 způsobuje zvýšené riziko onemocnění různými nádorovými onemocněními, včetně karcinomu prsu. [3, 93] Mutace genu p53 byla nejčastěji identifikována právě u tohoto onemocnění a je spojena s horší prognózou. Bylo prokázáno, že mutace v tomto genu je spojena s rezistencí k endokrinní terapii, radioterapii i k chemoterapii. [11] Dále byla také prokázaná pozitivní korelace mezi mutací genu p53 a zvýšenou hladinou MT1 a MT2 u nádorových onemocnění. [78] Prediktivní faktory léčebné odpovědi K hodnocení prognostických a prediktivních informací o reakci na léčbu pacientky se používají následující faktory: estrogenový receptor (ER), progesteronový receptor (PR) a HER2 (human epidermal growth factor receptor 2). [79]. V současně době se uznává především kombinace těchto faktorů pospolu. V tomto případě se nejedná o cirkulující markery, ale stanovují se přímo z izolované tkáně. [77] 21

Monitorování hladiny metalothioneinu a thiolových sloučenin u biologických organismů vystavených působení kovových prvků a sloučenin

Monitorování hladiny metalothioneinu a thiolových sloučenin u biologických organismů vystavených působení kovových prvků a sloučenin Laboratoř Metalomiky a Nanotechnologií Monitorování hladiny metalothioneinu a thiolových sloučenin u biologických organismů vystavených působení kovových prvků a sloučenin Ing. Kateřina Tmejová, Ph. D.,


1. Metodika. Protokol č. F1-4 Metodika: Srovnávací analýza efektivity přípravy rekombinantního proteinu ve fermentoru

1. Metodika. Protokol č. F1-4 Metodika: Srovnávací analýza efektivity přípravy rekombinantního proteinu ve fermentoru Protokol č.: F1-4 Datum: 20.12.2010 Metodika: analýza efektivity přípravy výběr z výsledků ze zkušebních provozů výroby antigenů. Vypracoval: Ing. Václav Filištein, Mgr. Tereza Chrudimská, Spolupracující





Úloha protein-nekódujících transkriptů ve virulenci patogenních bakterií

Úloha protein-nekódujících transkriptů ve virulenci patogenních bakterií Téma bakalářské práce: Úloha protein-nekódujících transkriptů ve virulenci patogenních bakterií Nové odvětví molekulární biologie se zabývá RNA molekulami, které se nepřekládají do proteinů, ale slouží


ONKOLOGIE. Laboratorní příručka Příloha č. 3 Seznam vyšetření imunochemie Verze: 05 Strana 23 (celkem 63)

ONKOLOGIE. Laboratorní příručka Příloha č. 3 Seznam vyšetření imunochemie Verze: 05 Strana 23 (celkem 63) ONKOLOGIE NÁZEV : PSA POUŽITÍ : kvantitativní stanovení celkového PSA (volného PSA i PSA v komplexu s alfa-1-antichymotrypsinem) v lidském séru. Společně s digitálním rektálním vyšetřením (DRE) se u mužů








Konečná zpráva hodnocení různých způsobů přípravy vzorků pro AMPLICOR HPV test firmy Roche

Konečná zpráva hodnocení různých způsobů přípravy vzorků pro AMPLICOR HPV test firmy Roche Konečná zpráva hodnocení různých způsobů přípravy vzorků pro AMPLICOR HPV test firmy Roche Charakteristika testu: Set AMPLICOR HPV vyráběný firmou Roche je určený pro detekci vysoko-rizikových typů lidských


Co nás učí nádory? Prof. RNDr. Jana Šmardová, CSc. Ústav patologie FN Brno Přírodovědecká a Lékařská fakulta MU Brno

Co nás učí nádory? Prof. RNDr. Jana Šmardová, CSc. Ústav patologie FN Brno Přírodovědecká a Lékařská fakulta MU Brno Co nás učí nádory? Prof. RNDr. Jana Šmardová, CSc. Ústav patologie FN Brno Přírodovědecká a Lékařská fakulta MU Brno Brno, 17.5.2011 Izidor (Easy Door) Osnova přednášky 1. Proč nás rakovina tolik zajímá?





Renáta Kenšová. Název: Školitel: Datum: 24. 10. 2014

Renáta Kenšová. Název: Školitel: Datum: 24. 10. 2014 Název: Školitel: Sledování distribuce zinečnatých iontů v kuřecím zárodku za využití moderních technik Monitoring the distribution of zinc ions in chicken embryo using modern techniques Renáta Kenšová


Biomarkery - diagnostika a prognóza nádorových onemocnění

Biomarkery - diagnostika a prognóza nádorových onemocnění Biomarkery - diagnostika a prognóza nádorových onemocnění O. Topolčan,M.Pesta, J.Kinkorova, R. Fuchsová Fakultní nemocnice a Lékařská fakulta Plzeň CZ.1.07/2.3.00/20.0040 a IVMZČR Témata přednášky Přepdpoklady






Column DNA Lego Kit UNIVERZÁLNÍ SOUPRAVY PRO RYCHLOU IZOLACI ČISTÉ DNA (Katalogové číslo D201 + D202) Column DNA Lego Kit UNIVERZÁLNÍ SOUPRAVY PRO RYCHLOU IZOLACI ČISTÉ DNA (Katalogové číslo D201 + D202) Popis Column DNA Lego Kit je základ moderní stavebnicové (Lego) soupravy pro izolaci čisté DNA různého


Izolace, separace a detekce proteinů a nukleových kyselin a jejich význam VOJTĚCH ADAM

Izolace, separace a detekce proteinů a nukleových kyselin a jejich význam VOJTĚCH ADAM Izolace, separace a detekce proteinů a nukleových kyselin a jejich význam VOJTĚCH ADAM Životní prostředí Obranné mechanismy Rostlinná buňka Živočišná buňka 2GS - M M GSH VAKUOLA GSH GSH *Aktivace* PC -



RNA Blue REAGENS PRO RYCHLOU PŘÍPRAVU ČISTÉ A NEDEGRADOVANÉ RNA (katalogové číslo R011, R012, R013) RNA Blue REAGENS PRO RYCHLOU PŘÍPRAVU ČISTÉ A NEDEGRADOVANÉ RNA (katalogové číslo R011, R012, R013) Upozornění: RNA Blue obsahuje fenol a další toxické komponenty. Při kontaktu s kůží je nutné omytí velkým



DIAGNOSTICKÝ KIT PRO DETEKCI MINIMÁLNÍ REZIUDÁLNÍ CHOROBY MRD EGFR Úvod IntellMed, s.r.o., Václavské náměstí 820/41, 110 00 Praha 1 DIAGNOSTICKÝ KIT PRO DETEKCI MINIMÁLNÍ REZIUDÁLNÍ CHOROBY MRD EGFR Jednou z nejvhodnějších metod pro detekci minimální reziduální choroby


Izolace nukleových kyselin

Izolace nukleových kyselin Izolace nukleových kyselin Požadavky na izolaci nukleových kyselin V nativním stavu z přirozeného materiálu v dostatečném množství požadované čistotě. Nukleové kyseliny je třeba zbavit všech látek, které


Izolace RNA. doc. RNDr. Jan Vondráček, PhD..

Izolace RNA. doc. RNDr. Jan Vondráček, PhD.. Izolace RNA doc. RNDr. Jan Vondráček, PhD.. Metodiky izolace RNA celková buněčná RNA ( total RNA) zahrnuje řadu typů RNA, které se mohou lišit svými fyzikálněchemickými vlastnostmi a tedy i nároky na jejich


Imunochemické metody. na principu vazby antigenu a protilátky

Imunochemické metody. na principu vazby antigenu a protilátky Imunochemické metody na principu vazby antigenu a protilátky ANTIGEN (Ag) specifická látka (struktura) vyvolávající imunitní reakci a schopná vazby na protilátku PROTILÁTKA (Ab antibody) molekula bílkoviny


Výskyt a význam infekce Borna disease virem u pacientů léčených

Výskyt a význam infekce Borna disease virem u pacientů léčených Výskyt a význam infekce Borna disease virem u pacientů léčených pro závislost Sylva Racková Psychiatrická klinika LF UK v Plzni AT konference 28.04. 2010, Špindlerův Mlýn Borna Disease virus (BDV) charakteristika


Humorální imunita. Nespecifické složky M. Průcha

Humorální imunita. Nespecifické složky M. Průcha Humorální imunita Nespecifické složky M. Průcha Humorální imunita Výkonné složky součásti séra Komplement Proteiny akutní fáze (RAF) Vztah k zánětu rozdílná funkce zánětu Zánět jako fyziologický kompenzační


Urychlení úpravy krvetvorby poškozené cytostatickou terapií (5-fluorouracil a cisplatina) p.o. aplikací IMUNORu

Urychlení úpravy krvetvorby poškozené cytostatickou terapií (5-fluorouracil a cisplatina) p.o. aplikací IMUNORu Urychlení úpravy krvetvorby poškozené cytostatickou terapií (5-fluorouracil a cisplatina) p.o. aplikací IMUNORu Úvod Myelosuprese (poškození krvetvorby) patří mezi nejčastější vedlejší účinky chemoterapie.


Praktický kurz Praktický kurz monitorování apoptózy a autofágie u nádorových prostatických buněk pomocí průtokové cytometrie

Praktický kurz Praktický kurz monitorování apoptózy a autofágie u nádorových prostatických buněk pomocí průtokové cytometrie Laboratoř Metalomiky a Nanotechnologií Praktický kurz Praktický kurz monitorování apoptózy a autofágie u nádorových prostatických buněk pomocí průtokové cytometrie Nastavení průtokového cytometru a jeho


ProGastrin-Releasing Peptide (ProGRP) u nemocných s malobuněčným karcinomem plic

ProGastrin-Releasing Peptide (ProGRP) u nemocných s malobuněčným karcinomem plic ProGastrin-Releasing Peptide (ProGRP) u nemocných s malobuněčným karcinomem plic FONS Symposium klinické biochemie Pardubice, 23.9. 25.9.202 M. Tomíšková, J. Skřičková, I. Klabenešová, M. Dastych 2 Klinika


Tekuté biopsie u mnohočetného myelomu

Tekuté biopsie u mnohočetného myelomu Tekuté biopsie u mnohočetného myelomu Mgr. Veronika Kubaczková Babákova myelomová skupina ÚPF LF MU Pacientský seminář 11. května 2016, Brno Co jsou tekuté biopsie? Představují méně zatěžující vyšetření


Veronika Janů Šárka Kopelentová Petr Kučera. Oddělení alergologie a klinické imunologie FNKV Praha

Veronika Janů Šárka Kopelentová Petr Kučera. Oddělení alergologie a klinické imunologie FNKV Praha Veronika Janů Šárka Kopelentová Petr Kučera Oddělení alergologie a klinické imunologie FNKV Praha interakce antigenu s protilátkou probíhá pouze v místech epitopů Jeden antigen může na svém povrchu nést


Erytrocyty. Hemoglobin. Krevní skupiny a Rh faktor. Krevní transfúze. Somatologie Mgr. Naděžda Procházková

Erytrocyty. Hemoglobin. Krevní skupiny a Rh faktor. Krevní transfúze. Somatologie Mgr. Naděžda Procházková Erytrocyty. Hemoglobin. Krevní skupiny a Rh faktor. Krevní transfúze. Somatologie Mgr. Naděžda Procházková Formované krevní elementy: Buněčné erytrocyty, leukocyty Nebuněčné trombocyty Tvorba krevních


Výzkumné centrum genomiky a proteomiky. Ústav experimentální medicíny AV ČR, v.v.i.

Výzkumné centrum genomiky a proteomiky. Ústav experimentální medicíny AV ČR, v.v.i. Výzkumné centrum genomiky a proteomiky Ústav experimentální medicíny AV ČR, v.v.i. Systém pro sekvenování Systém pro čipovou analýzu Systém pro proteinovou analýzu Automatický sběrač buněk Systém pro sekvenování


Aspartátaminotransferáza (AST)

Aspartátaminotransferáza (AST) 1 Aspartátaminotransferáza (AST) AST je buněčný enzym přítomný v řadě tkání, jako jsou srdce, kosterní svaly, ledviny, mozek, játra, pankreas či erytrocyty. Vyskytuje se ve dvou izoformách, cytoplazmatické


Nové metody v průtokové cytometrii. Vlas T., Holubová M., Lysák D., Panzner P.

Nové metody v průtokové cytometrii. Vlas T., Holubová M., Lysák D., Panzner P. Nové metody v průtokové cytometrii Vlas T., Holubová M., Lysák D., Panzner P. Průtoková cytometrie Analytická metoda využívající interakce částic a záření. Technika se vyvinula z počítačů částic Počítače


Určení koncentrace proteinu fluorescenční metodou v mikrotitračních destičkách

Určení koncentrace proteinu fluorescenční metodou v mikrotitračních destičkách Určení koncentrace proteinu fluorescenční metodou v mikrotitračních destičkách Teorie Stanovení celkových proteinů Celkové množství proteinů lze stanovit pomocí několika metod; například: Hartree-Lowryho


Izolace genomové DNA ze savčích buněk, stanovení koncentrace DNA pomocí absorpční spektrofotometrie

Izolace genomové DNA ze savčích buněk, stanovení koncentrace DNA pomocí absorpční spektrofotometrie Izolace genomové DNA ze savčích buněk, stanovení koncentrace DNA pomocí absorpční spektrofotometrie IZOLACE GENOMOVÉ DNA Deoxyribonukleová kyselina (DNA) představuje základní genetický materiál většiny


Beličková 1, J Veselá 1, E Stará 1, Z Zemanová 2, A Jonášová 2, J Čermák 1

Beličková 1, J Veselá 1, E Stará 1, Z Zemanová 2, A Jonášová 2, J Čermák 1 Beličková 1, J Veselá 1, E Stará 1, Z Zemanová 2, A Jonášová 2, J Čermák 1 1 Ústav hematologie a krevní transfuze, Praha 2 Všeobecná fakultní nemocnice, Praha MDS Myelodysplastický syndrom (MDS) je heterogenní


Rozbor léčebné zátěže Thomayerovy nemocnice onkologickými pacienty a pilotní prezentace výsledků péče

Rozbor léčebné zátěže Thomayerovy nemocnice onkologickými pacienty a pilotní prezentace výsledků péče Rozbor léčebné zátěže Thomayerovy nemocnice onkologickými pacienty a pilotní prezentace výsledků péče Výstupy analýzy dat zdravotnického zařízení a Národního onkologického registru ČR Prof. MUDr. Jitka


CA15-3 IRMA Souprava CA15-3 IRMA umožňuje přímé in-vitro kvantitativní stanovení s tumorem asociovaného antigenu CA15-3 v lidském séru

CA15-3 IRMA Souprava CA15-3 IRMA umožňuje přímé in-vitro kvantitativní stanovení s tumorem asociovaného antigenu CA15-3 v lidském séru Informace o výrobku Informace o ostatních produktech jsou dostupné na www.demeditec.com Návod k použití CA15-3 IRMA Souprava CA15-3 IRMA umožňuje přímé in-vitro kvantitativní stanovení s tumorem asociovaného


Personalizovaná medicína Roche v oblasti onkologie. Olga Bálková, Roche s.r.o., Diagnostics Division Pracovní dny, Praha, 11.

Personalizovaná medicína Roche v oblasti onkologie. Olga Bálková, Roche s.r.o., Diagnostics Division Pracovní dny, Praha, 11. Personalizovaná medicína Roche v oblasti onkologie Olga Bálková, Roche s.r.o., Diagnostics Division Pracovní dny, Praha, 11. listopadu 2013 Personalizovaná vs standardní péče Cílená léčba Spojení diagnostiky


Stanovení biomarkerů oxidativního stresu u kapra obecného (Cyprinus carpio L.) po dlouhodobém působení simazinu Hlavní řešitel Ing.

Stanovení biomarkerů oxidativního stresu u kapra obecného (Cyprinus carpio L.) po dlouhodobém působení simazinu Hlavní řešitel Ing. Stanovení biomarkerů oxidativního stresu u kapra obecného (Cyprinus carpio L.) po dlouhodobém působení simazinu Hlavní řešitel Ing. Alžběta Stará Vedoucí projektu dr. hab. Ing. Josef Velíšek, Ph.D. 1 Úvod


Lekce z analýz genových expresních profilů u MM a návrh panelu genů pro ČR. Mgr. Silvie Dudová

Lekce z analýz genových expresních profilů u MM a návrh panelu genů pro ČR. Mgr. Silvie Dudová Lekce z analýz genových expresních profilů u MM a návrh panelu genů pro ČR Mgr. Silvie Dudová Centrum základního výzkumu pro monoklonální gamapatie a mnohočetný myelom, ILBIT LF MU Brno Laboratoř experimentální





Diagnostika genetických změn u papilárního karcinomu štítné žlázy

Diagnostika genetických změn u papilárního karcinomu štítné žlázy Diagnostika genetických změn u papilárního karcinomu štítné žlázy Vlasta Sýkorová Oddělení molekulární endokrinologie Endokrinologický ústav, Praha Nádory štítné žlázy folikulární buňka parafolikulární


*Mléko a mléčné výrobky obsahují řadu bioaktivních

*Mléko a mléčné výrobky obsahují řadu bioaktivních www.bileplus.cz Mléko a mléčné výrobky obsahují řadu bioaktivních látek (vápník, mastné kyseliny, syrovátka, větvené aminokyseliny) ovlivňující metabolismus tuků spalování tuků Mléčné výrobky a mléčné


Tkáňový homogenizátor MagNA Lyser od společnosti Roche

Tkáňový homogenizátor MagNA Lyser od společnosti Roche Izolace RNA Pracovní postup Homogenizace: Pozn. Postup homogenizace platí pouze pro izolaci RNA z nativní tkáně, v případě izolace z buněčné suspenze je tento krok vynechán a začíná se přídavkem homogenizačního


Inovace studia molekulární a buněčné biologie

Inovace studia molekulární a buněčné biologie Inovace studia molekulární a buněčné biologie Tento projekt je spolufinancován Evropským sociálním fondem a státním rozpočtem České republiky. MBIO1/Molekulární biologie 1 Tento projekt je spolufinancován


Buňky, tkáně, orgány, soustavy

Buňky, tkáně, orgány, soustavy Lidská buňka buněčné organely a struktury: Jádro Endoplazmatické retikulum Goldiho aparát Mitochondrie Lysozomy Centrioly Cytoskelet Cytoplazma Cytoplazmatická membrána Buněčné jádro Jadérko Karyoplazma


Sandwichová metoda. x druhů mikrokuliček rozlišených různou kombinací barev (spektrální kód)

Sandwichová metoda. x druhů mikrokuliček rozlišených různou kombinací barev (spektrální kód) Jindra Vrzalová x druhů mikrokuliček rozlišených různou kombinací barev (spektrální kód) na každém druhu je navázána molekula vázající specificky jeden analyt (protilátka, antigen, DNAsonda,,) Sandwichová


RNDr. Klára Kobetičová, Ph.D.

RNDr. Klára Kobetičová, Ph.D. ENVIRONMENTÁLNÍ TOXIKOLOGIE ÚVODNÍ PŘEDNÁŠKA RNDr. Klára Kobetičová, Ph.D. Laboratoř ekotoxikologie a LCA, Ústav chemie ochrany prostředí, Fakulta technologie ochrany prostředí, VŠCHT Praha ÚVOD Předmět



VÝZNAM REGULACE APOPTÓZY V MEDICÍNĚ REGULACE APOPTÓZY 1 VÝZNAM REGULACE APOPTÓZY V MEDICÍNĚ Příklad: Regulace apoptózy: protein p53 je klíčová molekula regulace buněčného cyklu a regulace apoptózy Onemocnění: více než polovina (70-75%) nádorů


Diagnostika infekce Chlamydia trachomatis pomocí molekulárně genetické metody real time PCR nejen u pacientek z gynekologických zařízení

Diagnostika infekce Chlamydia trachomatis pomocí molekulárně genetické metody real time PCR nejen u pacientek z gynekologických zařízení Diagnostika infekce Chlamydia trachomatis pomocí molekulárně genetické metody real time PCR nejen u pacientek z gynekologických zařízení Mgr. Klára Vilimovská Dědečková, Ph.D. Synlab genetics s.r.o. Molekulární



RIGORÓZNÍ OTÁZKY - BIOLOGIE ČLOVĚKA RIGORÓZNÍ OTÁZKY - BIOLOGIE ČLOVĚKA 1. Genotyp a jeho variabilita, mutace a rekombinace Specifická imunitní odpověď Prevence a časná diagnostika vrozených vad 2. Genotyp a prostředí Regulace buněčného


Hodnocení účinku cytostatik a inhibitorů histondeacetylázy na nádorové buňky in vitro

Hodnocení účinku cytostatik a inhibitorů histondeacetylázy na nádorové buňky in vitro Hodnocení účinku cytostatik a inhibitorů histondeacetylázy na nádorové buňky in vitro T.Groh 1,2, J.Hraběta 1, T.Eckschlager 1 1 Klinika dětské hematologie a onkologie, 2.LF UK a FN Motol a 2 Katedra biochemie


Energetický metabolizmus buňky

Energetický metabolizmus buňky Energetický metabolizmus buňky Buňky vyžadují neustálý přísun energie pro tvorbu a udržování biologického pořádku (život). Tato energie pochází z energie chemických vazeb v molekulách potravy (energie


Abiotický stres - sucho

Abiotický stres - sucho FYZIOLOGIE STRESU Typy stresů Abiotický (vliv vnějších podmínek) sucho, zamokření, zasolení půd, kontaminace prostředí toxickými látkami, chlad, mráz, vysoké teploty... Biotický (způsobený jiným druhem





Identifikace a charakterizace metalothioneinu v nádorových buňkách pomocí MALDI-TOF/TOF hmotnostní spektrometrie

Identifikace a charakterizace metalothioneinu v nádorových buňkách pomocí MALDI-TOF/TOF hmotnostní spektrometrie Identifikace a charakterizace metalothioneinu v nádorových buňkách pomocí MALDI-TOF/TOF hmotnostní spektrometrie 14.6.2013 MSc. Miguel Ángel Merlos Rodrigo Ústav chemie a biochemie, Agronomická fakulta,


Projekt realizovaný na SPŠ Nové Město nad Metují

Projekt realizovaný na SPŠ Nové Město nad Metují Projekt realizovaný na SPŠ Nové Město nad Metují s finanční podporou v Operačním programu Vzdělávání pro konkurenceschopnost Královéhradeckého kraje Modul 02 Přírodovědné předměty Hana Gajdušková 1 Viry


Výskyt MHC molekul. RNDr. Ivana Fellnerová, Ph.D. ajor istocompatibility omplex. Funkce MHC glykoproteinů

Výskyt MHC molekul. RNDr. Ivana Fellnerová, Ph.D. ajor istocompatibility omplex. Funkce MHC glykoproteinů RNDr. Ivana Fellnerová, Ph.D. Katedra zoologie, PřF UP Olomouc = ajor istocompatibility omplex Skupina genů na 6. chromozomu (u člověka) Kódují membránové glykoproteiny, tzv. MHC molekuly, MHC molekuly


Evropský den onemocnění prostaty 15. září 2005 Aktivita Evropské urologické asociace a České urologické společnosti

Evropský den onemocnění prostaty 15. září 2005 Aktivita Evropské urologické asociace a České urologické společnosti Evropský den onemocnění prostaty 15. září 2005 Aktivita Evropské urologické asociace a České urologické společnosti prim. MUDr. Jan Mečl Urologické oddělení Krajská nemocnice Liberec Co je to prostata?


Výukový materiál zpracován v rámci projektu EU peníze školám Registrační číslo projektu: CZ.1.07/1.5.00/34.0996

Výukový materiál zpracován v rámci projektu EU peníze školám Registrační číslo projektu: CZ.1.07/1.5.00/34.0996 Výukový materiál zpracován v rámci projektu EU peníze školám Registrační číslo projektu: CZ.1.07/1.5.00/34.0996 Šablona: III/2 č. materiálu: VY_32_INOVACE_CHE_419 Jméno autora: Třída/ročník: Mgr. Alena





Regulace metabolizmu lipidů

Regulace metabolizmu lipidů Regulace metabolizmu lipidů Principy regulace A) krátkodobé (odpověď s - min): Dostupnost substrátu Alosterické interakce Kovalentní modifikace (fosforylace/defosforylace) B) Dlouhodobé (odpověď hod -



Příprava vektoru IZOLACE PLASMIDU ALKALICKÁ LYZE, KOLONKOVÁ IZOLACE DNA GELOVÁ ELEKTROFORÉZA RESTRIKČNÍ ŠTĚPENÍ. E. coli. lyze buňky. Příprava vektoru IZOLCE PLSMIDU LKLICKÁ LYZE, KOLONKOVÁ IZOLCE DN E. coli plasmidová DN proteiny proteiny + + vysrážená plasmidová lyze buňky + snížení ph chromosomální DN centrifugace DN chromosomální


Modul obecné onkochirurgie

Modul obecné onkochirurgie Modul obecné onkochirurgie 1. Principy kancerogeneze, genetické a epigenetické faktory 2. Onkogeny, antionkogeny, reparační geny, instabilita nádorového genomu 3. Nádorová proliferace a apoptóza, důsledky


Metody testování humorální imunity

Metody testování humorální imunity Metody testování humorální imunity Co je to humorální imunita? Humorální = látková Buněčné produkty Nespecifická imunita příklady:» Lysozym v slinách, slzách» Sérové proteiny (proteiny akutní fáze)» Komplementový


tky proti annexinu V Protilátky u trombofilních stavů u opakovaných těhotenských ztrát 2003 By Default! Slide 1

tky proti annexinu V Protilátky u trombofilních stavů u opakovaných těhotenských ztrát 2003 By Default! Slide 1 Slide 1 Protilátky tky proti annexinu V u systémových onemocnění pojiva u trombofilních stavů u opakovaných těhotenských ztrát VFN 24.4.2007 Slide 2 ANNEXINY Annexiny jsou proteiny, společnou vlastností



PREZENTACE ANTIGENU A REGULACE NA ÚROVNI Th (A DALŠÍCH) LYMFOCYTŮ PREZENTACE ANTIGENU PREZENTACE ANTIGENU A REGULACE NA ÚROVNI Th (A DALŠÍCH) LYMFOCYTŮ PREZENTACE ANTIGENU Podstata prezentace antigenu (MHC restrikce) byla objevena v roce 1974 V současnosti je zřejmé, že to je jeden z klíčových


HbA1c. Axis - Shield. Společnost je zapsána v obchodním rejstříku Městského soudu v Praze, odd. C vložka 1299

HbA1c. Axis - Shield. Společnost je zapsána v obchodním rejstříku Městského soudu v Praze, odd. C vložka 1299 Lékařská technika a speciální zdravotní materiál Společnost je zapsána v obchodním rejstříku Městského soudu v Praze, odd. C vložka 1299 Obchodní 110, 251 70 Praha Čestlice Tel. +420 296 328 300 Fax. +420


Enzymy v diagnostice Enzymy v plazm Bun né enzymy a sekre ní enzymy iny zvýšené aktivity bun ných enzym v plazm asový pr h nár

Enzymy v diagnostice Enzymy v plazm Bun né enzymy a sekre ní enzymy iny zvýšené aktivity bun ných enzym v plazm asový pr h nár Enzymy v diagnostice Enzymy v plazmě Enzymy nalézané v plazmě lze rozdělit do dvou typů. Jsou to jednak enzymy normálně přítomné v plazmě a mající zde svou úlohu (např. enzymy kaskády krevního srážení


AUG STOP AAAA S S. eukaryontní gen v genomové DNA. promotor exon 1 exon 2 exon 3 exon 4. kódující oblast. introny

AUG STOP AAAA S S. eukaryontní gen v genomové DNA. promotor exon 1 exon 2 exon 3 exon 4. kódující oblast. introny eukaryontní gen v genomové DNA promotor exon 1 exon 2 exon 3 exon 4 kódující oblast introny primární transkript (hnrna, pre-mrna) postranskripční úpravy (vznik maturované mrna) syntéza čepičky AUG vyštěpení


Příloha list Laboratorní příručky

Příloha list Laboratorní příručky _ Datum aktualizace: 15. 2.2014 Příloha list Laboratorní příručky Název metody: ASGPR Název metody na výsledcích laboratorního vyšetření: S_ASGPR IgG Jednotky: index Indikace: diferenciální diagnostika



IMUNOCYTOCHEMICKÁ METODA JEJÍ PRINCIP A VYUŽITÍ V LABORATOŘI IMUNOCYTOCHEMICKÁ METODA JEJÍ PRINCIP A VYUŽITÍ V LABORATOŘI Radka Závodská, PedF JU v Českých Budějovicích Imunocytochemická metoda - použítí protilátky k detekci antigenu v buňkách (Imunohistochemie-





Diferenciální diagnostika SCLC s využitím markerů Elecsys progrp a Elecsys NSE

Diferenciální diagnostika SCLC s využitím markerů Elecsys progrp a Elecsys NSE Diferenciální diagnostika SCLC s využitím markerů Elecsys progrp a Elecsys NSE Ing. Eva Herkommerová, PhD. prim. MUDr. Hana Mrázková Krajská zdravotní, a.s.- Nemocnice Most 1. Oddělení laboratorního komplementu


Zjišťování toxicity látek

Zjišťování toxicity látek Zjišťování toxicity látek 1. Úvod 2. Literární údaje 3. Testy in vitro 4. Testy na zvířatech in vivo 5. Epidemiologické studie 6. Zjišťování úrovně expozice Úvod Je známo 2 10 7 chemických látek. Prostudování



METABOLISMUS SACHARIDŮ METABOLISMUS SAHARIDŮ A. Odbourávání sacharidů - nejdůležitější zdroj energie pro heterotrofy - oxidací sacharidů až na. získávají aerobní organismy energii ve formě. - úplná oxidace glukosy: složitý proces


ONKOGENETIKA. Spojuje: - lékařskou genetiku. - buněčnou biologii. - molekulární biologii. - cytogenetiku. - virologii

ONKOGENETIKA. Spojuje: - lékařskou genetiku. - buněčnou biologii. - molekulární biologii. - cytogenetiku. - virologii ONKOGENETIKA Spojuje: - lékařskou genetiku - buněčnou biologii - molekulární biologii - cytogenetiku - virologii Důležitost spolupráce různých specialistů při detekci hereditárních forem nádorů - (onkologů,internistů,chirurgů,kožních


Funkční testy: BasoFlowEx Kit FagoFlowEx Kit

Funkční testy: BasoFlowEx Kit FagoFlowEx Kit Mgr. Martin Čonka EXBIO Praha, a.s. Funkční testy: BasoFlowEx Kit FagoFlowEx Kit Funkční testy napodobení biologický procesů in vitro nehrozí nebezpečí ohrožení pacienta v průběhu testování možná analýza


Biologická léčba karcinomu prsu. Prof. MUDr. Jitka Abrahámová, DrSc. Onkologická klinika 1.LF UK a TN KOC (NNB+VFN+TN)

Biologická léčba karcinomu prsu. Prof. MUDr. Jitka Abrahámová, DrSc. Onkologická klinika 1.LF UK a TN KOC (NNB+VFN+TN) Biologická léčba karcinomu prsu Prof. MUDr. Jitka Abrahámová, DrSc. Onkologická klinika 1.LF UK a TN KOC (NNB+VFN+TN) Cílená léčba Ca prsu Trastuzumab (HercepNn) AnN HER2 neu pronlátka LapaNnib (Tyverb)


Přínos molekulární genetiky pro diagnostiku a terapii malignit GIT v posledních 10 letech

Přínos molekulární genetiky pro diagnostiku a terapii malignit GIT v posledních 10 letech Přínos molekulární genetiky pro diagnostiku a terapii malignit GIT v posledních 10 letech Minárik M. Centrum aplikované genomiky solidních nádorů (CEGES), Genomac výzkumný ústav, Praha XXIV. JARNÍ SETKÁNÍ


Gymnázium a Střední odborná škola, Rokycany, Mládežníků 1115

Gymnázium a Střední odborná škola, Rokycany, Mládežníků 1115 Gymnázium a Střední odborná škola, Rokycany, Mládežníků 1115 Číslo projektu: CZ.1.07/1.5.00/34.0410 Číslo šablony: V/2 - inovace směřující k rozvoji odborných kompetencí Název materiálu: Buněčný cyklus


Biologické materiály k biochemickému vyšetření

Biologické materiály k biochemickému vyšetření Biologické materiály k biochemickému vyšetření RNDr. Bohuslava Trnková, ÚKBLD 1. LF UK ls 1 Správný odběr vzorku - první předpoklad k získání správného výsledku preanalytická fáze analytická fáze - vlastní



OBRANNÝ IMUNITNÍ SYSTÉM Mgr. Šárka Vopěnková Gymnázium, SOŠ a VOŠ Ledeč nad Sázavou VY_32_INOVACE_02_3_04_BI2 OBRANNÝ IMUNITNÍ SYSTÉM Základní znaky: není vrozená specificky rozpoznává cizorodé látky ( antigeny) vyznačuje se



ZÁKLADY FUNKČNÍ ANATOMIE OBSAH Úvod do studia 11 1 Základní jednotky živé hmoty 13 1.1 Lékařské vědy 13 1.2 Buňka - buněčné organely 18 1.2.1 Biomembrány 20 1.2.2 Vláknité a hrudkovité struktury 21 1.2.3 Buněčná membrána 22 1.2.4


Laboratorní workshop s teoreticko praktickou ukázkou molekulárně biologických technik ve spolupráci s firmou ROCHE

Laboratorní workshop s teoreticko praktickou ukázkou molekulárně biologických technik ve spolupráci s firmou ROCHE BiochemNet vytvoření sítě pro podporu spolupráce biomedicínských pracovišť a zvýšení uplatnitelnosti absolventů biochemických oborů v praxi Laboratorní workshop s teoreticko praktickou ukázkou molekulárně


Protein S100B Novinky a zajímavosti

Protein S100B Novinky a zajímavosti Protein S100B Novinky a zajímavosti Olga Bálková, Roche s.r.o., Diagnostics Division Odborný seminář Roche, Kurdějov, 29. dubna 2014 S100: biochemické minimum S100 = kalcium vážící nízkomolekulární proteiny


Ústav experimentální medicíny AV ČR úspěšně rozšířil přístrojové vybavení pro vědce z peněz evropských fondů

Ústav experimentální medicíny AV ČR úspěšně rozšířil přístrojové vybavení pro vědce z peněz evropských fondů Ústav experimentální medicíny AV ČR úspěšně rozšířil přístrojové vybavení pro vědce z peněz evropských fondů Ústav úspěšně dokončil realizaci dvou investičních projektů s využitím prostředků z Operačního


Aktivní B12 (Holotranskobalamin) pokrok v diagnostice deficitu vitaminu B12

Aktivní B12 (Holotranskobalamin) pokrok v diagnostice deficitu vitaminu B12 Aktivní B12 (Holotranskobalamin) pokrok v diagnostice deficitu vitaminu B12 Firma Abbott Laboratories nabízí na imunoanalytických systémech ARCHITECT test ke stanovení biologicky aktivní části vitaminu


Regulace glykémie. Jana Mačáková

Regulace glykémie. Jana Mačáková Regulace glykémie Jana Mačáková Katedra fyziologie a patofyziologie LF OU Ústav patologické fyziologie LF UP Název projektu: Tvorba a ověření e-learningového prostředí pro integraci výuky preklinických


Mikromorfologická diagnostika bronchogenního karcinomu z pohledu pneumologické cytodiagnostiky

Mikromorfologická diagnostika bronchogenního karcinomu z pohledu pneumologické cytodiagnostiky Mikromorfologická diagnostika bronchogenního karcinomu z pohledu pneumologické cytodiagnostiky P. Žáčková Pneumologická klinika 1. LFUK Thomayerova nemocnice Úvod a definice Každá buňka obsahuje informace





Bílkoviny a rostlinná buňka

Bílkoviny a rostlinná buňka Bílkoviny a rostlinná buňka Bílkoviny Rostliny --- kontinuální diferenciace vytváření orgánů: - mitotická dělení -zvětšování buněk a tvorba buněčné stěny syntéza bílkovin --- fotosyntéza syntéza bílkovin


Fyziologická regulační medicína

Fyziologická regulační medicína Fyziologická regulační medicína Otevírá nové obzory v medicíně! Pacienti hledající dlouhodobou léčbu bez nežádoucích účinků mohou být nyní uspokojeni! 1 FRM italská skupina Zakladatelé GUNY 2 GUNA-METODA


Exprese rekombinantních proteinů

Exprese rekombinantních proteinů Exprese rekombinantních proteinů Exprese rekombinantních proteinů je proces, při kterém můžeme pomocí různých expresních systémů vytvořit protein odvozený od konkrétního genu, nebo části genu. Tento protein


Western blotting. 10% APS 20,28 µl 40,56 µl 81,12 µl 20,28 µl 40,56 µl 81,12 µl

Western blotting. 10% APS 20,28 µl 40,56 µl 81,12 µl 20,28 µl 40,56 µl 81,12 µl Western blotting 1. Příprava gelu složení aparatury hustotu gelu volit podle velikosti proteinů příprava rozdělovacího gelu: 10% 12% počet gelů 1 2 4 1 2 4 objem 6 ml 12 ml 24 ml 6 ml 12 ml 24 ml 40% akrylamid





S filtračními papíry a membránou je nutno manipulovat pinzetou s tupým koncem.

S filtračními papíry a membránou je nutno manipulovat pinzetou s tupým koncem. Western Blotting Příprava blotovacího sendviče... 1 Blotování... 2 Kontrola přenesení proteinů na membránu... 2 Blokování membrány... 2 Aplikace protilátek... 2 Vizualizace... 3 Vyvolání filmu... 4 Chemikálie





7. Regulace genové exprese, diferenciace buněk a epigenetika

7. Regulace genové exprese, diferenciace buněk a epigenetika 7. Regulace genové exprese, diferenciace buněk a epigenetika Aby mohl mnohobuněčný organismus efektivně fungovat, je třeba, aby se jednotlivé buňky specializovaly na určité funkce. Nový jedinec přitom


Cvičení č. 2: Pasážování buněk. 1) Teoretický základ

Cvičení č. 2: Pasážování buněk. 1) Teoretický základ Cvičení č. 2: Pasážování buněk 1) Teoretický základ Kultivace buněk in vitro (ve zkumavce) - Snaha o napodobení podmínek v organismu - Používání jednorázového spotřebního materiálu a speciálních chemikálií


CYTO projekt: Studie průniku cytostatik přes pokožku a orální epitel

CYTO projekt: Studie průniku cytostatik přes pokožku a orální epitel CYTO projekt: Studie průniku cytostatik přes pokožku a orální epitel PharmDr. Doležalová, Mgr.Odráška, Mgr. Gorná, Vejpustková, R., doc.mgr.bláha,ph.d. Ústavní lékárna, Masarykův onkologický ústav Profesní
