Kap. 6 Vývojové procesy určované polohou ve vztahu k určité buňce, pletivu či orgánu (Origins of periodic patterns)
Ekvivalentní a neekvivalentní buňky u živočichů a rostlin laterální (bočná) specifikace(vymezení) indukce
Trichome differentiation
Trichom- Entwicklung Arabidopsis thaliana
glabrous (glabra?) mutants wt gl GL2 transcription pattern
(GL3)
TTG1 The protein is mapped to the transparent testa glabra1 locus. This locus regulates several developmental and biochemical pathways in Arabidopsis, including the formation of hairs on leaves, stems, and roots, and the production of seed mucilage and anthocyanin pigments (purple coloured seedlings). This protein is similar to AN11, a regulator of anthocyanin biosynthesis in petunia, and is more distantly related to those of the β-subunits of heterotrimeric G proteins, which suggests a role for TTG1 in signal transduction to downstream transcription factors.
TTG1 FUNCTION it may regulate MYC transcription factors involved in trichome and root hair development, seed mucilage production, and anthocyanin biosynthesis by acting at the dihydorflavonol-4- reductase (DFR) step or it may regulate pathways that involve MYC factors SUBCELLULAR LOCATION - cytoplasmic. TISSUE SPECIFICITY - Roots, leaves, stems, meristems, flowers and flower buds. SIMILARITY - Contains 4 WD40 repeats (Proteins containing WD40 repeats are involved in a number of different types of regulatory roles, such as signalling, cell cycle regulation, transcriptional repression, vesicular trafficking and RNA processing)
Post Translational Modifications Predicted by PROSITE MDNSAPDSLSRSETAVTYDSPYPLYAMAFSSLRSSSGHRIAVGSFLE DYNNRIDILSFDSDSMTVKPLPNLSFEHPYPPTKLMFSPPSLRRPSSG DLLASSGDFLRLWEINEDSSTVEPISVLNNSKTSEFCAPLTSFDWNDV EPKRLGTCSIDTTCTIWDIEKSVVETQLIAHDKEVHDIAWGEARVFASV SADGSVRIFDLRDKEHSTIIYESPQPDTPLLRLAWNKQDLRYMATILM DSNKVVILDIRSPTMPVAELERHQASVNAIAWAPQSCKHICSGGDDT QALIWELPTVAGPNGIDPMSVYSAGSEINQLQWSSSQPDWIGIAFAN KMQLLRV N-glycosylation sites tyrosine sulphate site camp- and cgmp- dependent protein kinase phosphorylation sites protein kinase C phosphorylation sites casein kinase II phosphorylation sites N-myristoylation sites in bold WD repeats region is underlined
Microarray analysis Shown to be highly expressed in two microarray experiments. Growth conditions caused TTG1 overexpression Normal light, darkness and then far red light
Arabidopsis thaliana transparent testa glabra 1 protein (TTG1) Encodes a protein of 341 amino acids localised to chromosome 5p and consists of 3 exons TTG1 protein does not act directly as a transcription factor but binds to other proteins to promote the initiation of trichomes in leaves and stems, it is also involved in regulating the transcription factors involved in seed mucilage production and anthocyanin biosynthesis. Summary
GLABRA1 transcription factor MYB related GL3 and maize R bhlh, MYB interactor
Triptychon (TRY) MYB-related inhibits trichome differentiation mutant - clusters
Alan TURING 1912-1954 1951-2 - Reakčně-difusní model
Root hair differentiation
GL2 brání růstu vlášení na pozici atrichoblastů GL2 = homeodomain txn factor
GL2 exprese (Schiefelbein lab) Photograph of wildtype (left), ttg mutant (center), and wer mutant (right) roots bearing the GL2::GUS transgene. Note that ttg and wer dramatically reduce GL2 gene expression.
WER: standardní MYB CPC: MYB bez transaktivace
CPC se ovšem exprimuje přednostně v atrichoblastech působí buněčně neautonomně transportuje se jako aktivátor trichoblastů do sousedních buněk trichoblastů
Patterning of stomata
Vasculature patterning
reakčně-difusní model (http://texturegarden.com/)
Phyllotaxis
Alan TURING 1912-1954 1951? nepublikovaná teorie fylotaxe
1941 discusses daisy patterns & fir cones with Joan Clarke 1947-1948 attends Cambridge undergraduate physiology lectures Feb 1951 Nov 1951 Manchester Mark I machine installed paper on the simple case - Chemical basis of morphogenesis 1952 Had quite a jolly time lecturing on fir cones 1952-1954 Drafts part of the Morphogen Theory of Phyllotaxis, finally published in 1992. Jonathan Swinton 2004. See http://www.swintons.net/jonathan/turing/
Morphogenesis: Collected Works of AM Turing, Volume 3, ed PT Saunders, North-Holland, 1992. This contains: An introduction by Saunders A reprint of The chemical basis of morphogenesis A diffusion-reaction theory of morphogenesis in plants The morphogen theory of phyllotaxis I The morphogen theory of phyllotaxis II Outline of the development of the daisy
my mathematical theory of embryology...is yielding to treatment, and it will so far as I can see, give satisfactory explanations of (i) gastrulation (ii) polygonally symmetrical structures, e.g. starfish, flowers (iii) leaf arrangements, in particular the way the Fibonacci series (0,1,1,2,3,5,8,13,...) comes to be involved (iv) colour patterns on some animals, e.g. stripes, spots and dappling (v) pattern on nearly spherical structures such as some Radiolara... A. Turing, 8th Feb 1951
Fylotaxe a Fibonacciho posloupnosti Turing archive Church, 1904
Dějiny fylotaxe - počátky 370-285 BC Theophrastus pravidelné uspořádání listů 1202 Leonardo Fibonacci Fibonacciho posloupnost <1, 1, 2, 3, 5,... F(k), F(k+1)> (mimo souvislost s fylotaxí) 1754 Charles Bonnet popis fylotaktic. spirál v moderním smyslu 1830-35 Schimper a Braun formalizace popisu; od té doby pokusy o matematické uchopení 1882 Julius Sachs odmítá matematic. modely... ale modelování pokračuje... i pokusy
D Arcy Wenworth Thompson 1860-1948 1917 On Growth and Form
This presentation is copyright Jonathan Swinton 2004. See http://www.swintons.net/jonathan/turing/turingcopyright.html for details and copyright owners of the images contained. Stems, cones and flowers Church, 1904 8 green parastichies 13 red parastichies
Experiment Douadyho a Coudera (1992) Drops of ferrofluids are deposited periodically at the center of a circular dish filled with silicon oil. Under the effect of magnets surrounding the dish, the drops repel one another and are attracted to the edge of the dish. To Douady and Couder s own amazement, when the magnetic field was slowly reduced during the process, the drops self-organized into Fibonacci phyllotactic patterns.
Realistický model fylotaxe Pattern generation by the transport-based model. (A D) Pattern emergence in a sequence of 50 cells with wraparound boundary conditions (the leftmost and the rightmost cell are considered neighbors). Taller bars (brighter green) indicate higher IAA concentration. Simulation steps 30, 60, 70, and 80 are shown. A small amount of noise is required to break symmetry. (E and F) Pattern dependence on model parameters. Higher values of the transport coefficient result in more peaks (G) Pattern formed in a simulated cellular structure. PIN1 is depicted in red. (R.S. Smith et al., PNAS 2006)
Shrnutí Specifikace typů buněk (pletiv, orgánů) v rámci rostlinného organismu je dána neustále probíhající vzájemnou signalizací-ovlivňováním vyvíjejících/diferencujících se buněk, pletiv a orgánů, které si tak vzájemně poskytují poziční informaci. Takové procesy jsou charakterizovány opakovanými zpětnovazebnými cykly, které amplifikují malé počáteční rozdíly. Vzájemná komunikace umožňuje pozdější úpravu počátečních odchylek od pravidelného uspořádání. Typickým jevem je repetitivní pravidelnost, kterou lze modelovat
Soběpodobnost a algoritmická povaha rostlinného těla aneb k čemu jsou vizuální modely
J.W. Goethe o algoritmické povaze rostliny Vorwärts und rückwärts ist die Pflanze immer nur Blatt. 17.5.1787 Es mag nun die Pflanze sprossen, blühen oder Früchte bringen, so sind es doch nur immer dieselbiger Organe, welche in vielfältigen Bestimmungen und unter oft veränderten Gestalten die Vorschrift der Natur erfüllen. 1790
Aristid Lindenmayer 1925-1989 1968 - Mathematical models for cellular interaction in development.
http://algorithmicbotany.org/
Náhodný pseudorealismus...
Ještě jednou fylotaxe... (pravidelnost není na škodu)
Fylotaxe kolizní model
Architektura bylin (jak zapracovat signály)
Šíření signálů rostlinou Akropetální kvetení Basipetální kvetení Architektura Mycelis muralis schématická a realistická
Modelování orgánů
Cellular L-systems
Přidejme spojitý čas... Složený list Apex Ailanthus Kvetení zvonek
Rostliny v prostředí (cestou k ekosystému)
Interakce s prostředím Klonální jetel a světlo Kompetice větví o světlo Kořen a voda v půdě
anebo? P.Prusinkiewicz: modelování vývojových mutantů, model fylotaxe uvažující relokalizaci PIN (PNAS 2006) O.Leyser + P.Prusinkiewicz: identifikace nového regulátoru dormance pupenů (MAX) see e.g. Berleth et al. TiPS 2007