Strukturní biologie. Vojtěch Spiwok.

Save this PDF as:
 WORD  PNG  TXT  JPG

Rozměr: px
Začít zobrazení ze stránky:

Download "Strukturní biologie. Vojtěch Spiwok. spiwokv@vscht.cz http://web.vscht.cz/spiwokv/modelovani/"

Transkript

1 Strukturní biologie Vojtěch Spiwok

2 Domácí úkol: Instrukce: Vytvořte obrázek prostorové struktury vylosovaného proteinu tak, aby z něj byla dobře patrná interakce proteinové části s ligandem nebo ligandy (kofaktory, inhibitory atd). Obrázek musí mít bílé pozadí. Pro proteinovou část použijte reprezentaci bez zobrazení jednotlivých atomů (např. ribon, cartoon a podobně). Pro neproteinovou část použijte zobrazení jednotlivých atomů (sticks, ball&sticks, spheres atd, ale ne lines). Pokud je to vhodné, je možné stejným způsobem zobrazit i atomy vybraných aminokyselinových zbytků. V případě vícepodjednotkových proteinů je možné zobrazit pouze jednu podjednotku, zvláště pokud se nejedná o biologický oligomer (např. je jejich interakce důsledkem krystalizace). V obrázku je možné popsat jednotlivé podjednotky, ligandy, rezidua a podobně. Pro tyto popisky použijte písmo Helvetica. Celý obrázek musí být ve formátu tiff, na šířku musí mít 6-8 cm a rozlišení 300 dpi. K obrázku připojte krátký popisek. V něm uveďte jaký software byl použit. Vhodný software: PyMol - VMD - UCSF Chimera - nebo jiný

3 Domácí úkol: 1e4v 1ffy 1gal 1ipw 1k22 1n2c 1u70 1upp 1v97 1w4w 1yq2 2fbw 2jhf 2r4f 2vk4 2x91 2xfu 3b7e 3div 3f0t 3g2h 3gzk 3ha1 3hw7 3i9v 3ihj 3jwq 3k4v 3lii 3lxe 3m8r 3maa 3n10 3n8v 3txt 4ake 4ea3 4k5y 4l0d 4l6r 4n6h 4oo9 4or2 8tim

4 Prostorové struktury proteinů

5 Prostorové struktury proteinů 4iy0 HEADER METAL TRANSPORT 28 JAN 13 4IY0 TITLE STRUCTURAL AND LIGAND BINDING PROPERTIES OF THE BATEMAN DOMAIN OF TITLE 2 HUMAN MAGNESIUM TRANSPORTERS CNNM2 AND CNNM4 COMPND MOL_ID: 1; COMPND 2 MOLECULE: METAL TRANSPORTER CNNM2; COMPND 3 CHAIN: A; COMPND 4 FRAGMENT: CBS DOMAIN, UNP RESIDUES ; COMPND 5 SYNONYM: ANCIENT CONSERVED DOMAIN CONTAINING PROTEIN 2, CYCLIN M2; COMPND 6 ENGINEERED: YES SOURCE MOL_ID: 1; SOURCE 2 ORGANISM_SCIENTIFIC: HOMO SAPIENS; SOURCE 3 ORGANISM_COMMON: HUMAN; SOURCE 4 ORGANISM_TAXID: 9606; SOURCE 5 GENE: CNNM2; SOURCE 6 EXPRESSION_SYSTEM: ESCHERICHIA COLI; SOURCE 7 EXPRESSION_SYSTEM_TAXID: 562; SOURCE 8 EXPRESSION_SYSTEM_STRAIN: BL21; SOURCE 9 EXPRESSION_SYSTEM_VECTOR_TYPE: PLASMID; SOURCE 10 EXPRESSION_SYSTEM_PLASMID: PET101D/TOPO KEYWDS CBS, BATEMAN DOMAIN, MAGNESIUM TRANSPORTER, MAGNESIUM SENSOR, KEYWDS 2 CYTOSOL, METAL TRANSPORT EXPDTA X RAY DIFFRACTION AUTHOR M.A.CORRAL RODRIGUEZ,M.STUIVER,J.A.ENCINAR,V.SPIWOK,I.GOMEZ GARCIA, AUTHOR 2 I.OYENARTE,J.ERENO ORBEA,H.TERASHIMA,A.ACCARDI,T.DIERCKS,D.MULLER, AUTHOR 3 L.A.MARTINEZ CRUZ REVDAT 1 05 MAR 14 4IY0 0 JRNL AUTH M.A.CORRAL RODRIGUEZ,M.STUIVER,J.A.ENCINAR,V.SPIWOK, JRNL AUTH 2 I.GOMEZ GARCIA,I.OYENARTE,J.ERENO ORBEA,H.TERASHIMA, JRNL AUTH 3 A.ACCARDI,T.DIERCKS,D.MULLER,L.A.MARTINEZ CRUZ JRNL TITL STRUCTURAL AND LIGAND BINDING PROPERTIES OF THE BATEMAN JRNL TITL 2 DOMAIN OF HUMAN MAGNESIUM TRANSPORTERS CNNM2 AND CNNM4 JRNL REF TO BE PUBLISHED

6 Prostorové struktury proteinů 4iy0 ATOM 1 N LYS A N ATOM 2 CA LYS A C ATOM 3 C LYS A C ATOM 4 O LYS A O ATOM 5 CB LYS A C ATOM 6 CG LYS A C ATOM 7 CD LYS A C ATOM 8 CE LYS A C ATOM 9 NZ LYS A N ATOM 10 N GLU A N ATOM 11 CA GLU A C ATOM 12 C GLU A C ATOM 13 O GLU A O ATOM 14 CB GLU A C... ATOM 1219 CD GLU A C ATOM 1220 OE1 GLU A O ATOM 1221 OE2 GLU A O TER 1222 GLU A 580 HETATM 1223 PB ADP A P HETATM 1224 O1B ADP A O HETATM 1225 O2B ADP A O HETATM 1226 O3B ADP A O HETATM 1227 PA ADP A P HETATM 1228 O1A ADP A O HETATM 1229 O2A ADP A O HETATM 1230 O3A ADP A O HETATM 1231 O5' ADP A O HETATM 1232 C5' ADP A C HETATM 1233 C4' ADP A C HETATM 1234 O4' ADP A O

7 Prostorové struktury proteinů 4iy0 Pymol VMD USCF Chimera https://www.cgl.ucsf.edu/chimera/

8 Předpověď prostorových struktur proteinů 1. Homologní modelování Proteiny s podobnou sekvencí mají (obvykle) podobnou prostorovou strukturu. 2. Identifikace způsobu sbalení Proteiny mohou mít podobnou prostorovou strukturu a nemusí mít (na první pohled) podobnou sekvenci. 3. Ab initio, de novo Nativní struktura proteinu má vlastnosti, které jí odlišují od ostatních struktur. 4. Simulace sbalování proteinu Nativní struktura je minimem volné energie proteinu.

9 Homologní modelování Proteiny s podobnou sekvencí mají (obvykle) podobnou prostorovou strukturu. Abl kinasa 1opl p38 kinasa 1w84 insulinový receptor 1irk

10 Homologní modelování Proteiny s podobnou sekvencí mají (obvykle) podobnou prostorovou strukturu. Abl kinasa 1opl >1OPL pdb, chain A/1 537 MGQQPGKVLGDQRRPSLPALHFIKGAGKRDSSRHGGPHCNVFVEHEALQRPVASDFEPQG LSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCE AQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQR SISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRN KPTVYGVSPNY DKWEMERTDITMKHKLGGGQYGEVYEGVWKKYS LTVAVKTLKE DTM EVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRE CNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRNLAARNCLVGENHLVKVADFGLS R LMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGID LSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISD EVEKELGKENLYFQ >1IRK pdb, chain A/ insulinový receptor VFPSSVFVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNE SASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPE 1irk AENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMT RDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLS NEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPS FP EVSFFHSEENK YGNLLDYLRE CNRQEVNAVVLLY HGDLKSYLRSLRPEAENNPGRPPPTLQEMIQ

11 Homologní modelování Proteiny s podobnou sekvencí mají (obvykle) podobnou prostorovou strukturu. Swiss Model Modeller https://salilab.org/modeller/ Postup: 1. nalezení sekvenčně podobného proteinu (proteinů) se známou prostorovou strukturou (např. BLAST) 2. zarovnání sekvencí (Clustal, NW) 3. vytvoření modelu (modeller) 4. kontrola modelu (Prosa, Verify3D)

12 Modeller Potřebujeme: 1. zarovnání sekvencí 2. struktury templátů 3. instrukce Zarovnání sekvencí Jméno souboru templátu číslo prvního residua číslo posledního residua C; A sample alignment in the PIR format; used in tutorial >P1;5fd1 structurex:5fd1:1 :A:106 :A:ferredoxin:Azotobacter vinelandii: 1.90: 0.19 AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELA EVWPNITEKKDPLPDAEDWDGVKGKLQHLER* >P1;1fdx sequence:1fdx:1 : :54 : :ferredoxin:peptococcus aerogenes: 2.00: 1.00 AYVINDSC IACGACKPECPVNIIQGS IYAIDADSCIDCGSCASVCPVGAPNPED * řetězec posledního residua Jméno modelu řetězec prvního residua

13 Modeller Potřebujeme: 1. zarovnání sekvencí 2. struktury templátů 3. instrukce umístění templátu(ů) Instrukce # Homology modeling by the automodel class from modeller import * # Load standard Modeller classes from modeller.automodel import * # Load the automodel class log.verbose() # request verbose output env = environ() # create a new MODELLER environment to build this model in # directories for input atom files env.io.atom_files_directory = ['.', '../atom_files'] název souboru zarovnání a = automodel(env, alnfile = 'alignment.ali', # alignment filename knowns = '5fd1', # codes of the templates sequence = '1fdx') # code of the target a.starting_model= 1 # index of the first model a.ending_model = 1 # index of the last model # (determines how many models to calculate) a.make() # do the actual homology modeling index posledního modelu název templátu(ů) název modelu

14 Modeller Potřebujeme: 1. zarovnání sekvencí 2. struktury templátů 3. instrukce Vlastní spuštění: python model default.py Vlastní spuštění: mod9.14 model default.py

15 Modeller Co dál? fúzní protein Templát1 XXXXXXXXXXXXXXXXXX Templát2 XXXXXXXXXXXXXXXXXXXXXXX model XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX inzerce Templát1 XXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXX Templát2 XXXXXX model XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX indukované přizpůsobení Templát1 XXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXX Templát2 XXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXX model XXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXX

16 Modeller Co dál? Více řetězců C; A sample alignment in the PIR format; used in tutorial >P1;1XXX structurex:1xxx:1 :A:666 :C:::: XXXXXXXXX... XXXXXXXXXXXXX/ XXX XX... XXX* >P1;model sequence:model:1 :C:::: XXXXXXXXX... XXXX XXXXX/ XXXXXXXXX... XXX*

17 Modeller Co dál allhmodel přidá vodíky # Homology modeling by the automodel class from modeller import * # Load standard Modeller classes from modeller.automodel import * # Load the automodel class log.verbose() # request verbose output env = environ() # create a new MODELLER environment to build this model in # directories for input atom files env.io.atom_files_directory = ['.', '../atom_files'] ('5fd1', '1xxx'), více templátů a = automodel(env, alnfile = 'alignment.ali', # alignment filename knowns = '5fd1', # codes of the templates sequence = '1fdx') # code of the target a.starting_model= 1 # index of the first model a.ending_model = 1 # index of the last model # (determines how many models to calculate) a.make() # do the actual homology modeling modelů

18 Modeller Co dál? Disulfidové můstky # Homology modeling by the automodel class from modeller import * # Load standard Modeller classes from modeller.automodel import * # Load the automodel class # Redefine the special_patches routine to include the additional disulfides # (this routine is empty by default): class MyModel(automodel): def special_patches(self, aln): # A disulfide between residues 8 and 45: self.patch(residue_type='disu', residues=(self.residues['8'], self.residues['45'])) log.verbose() # request verbose output env = environ() # create a new MODELLER environment to build this model in # directories for input atom files env.io.atom_files_directory = ['.', '../atom_files'] a = MyModel(env, alnfile = 'alignment.ali', # alignment filename knowns = '5fd1', # codes of the templates sequence = '1fdx') # code of the target a.starting_model= 1 # index of the first model a.ending_model = 1 # index of the last model # (determines how many models to calculate) a.make() # do the actual homology modeling

19 Modeller Co dál? Vnucení sekundární struktury # Homology modeling by the automodel class from modeller import * # Load standard Modeller classes from modeller.automodel import * # Load the automodel class class MyModel(automodel): def special_restraints(self, aln): rsr = self.restraints at = self.atoms rsr.add(secondary_structure.alpha(self.residue_range('20:', '30:'))) log.verbose() # request verbose output env = environ() # create a new MODELLER environment to build this model in # directories for input atom files env.io.atom_files_directory = ['.', '../atom_files'] a = MyModel(env, alnfile = 'alignment.ali', # alignment filename knowns = '5fd1', # codes of the templates sequence = '1fdx') # code of the target a.starting_model= 1 # index of the first model a.ending_model = 1 # index of the last model # (determines how many models to calculate) a.make() # do the actual homology modeling

20 Identifikace způsobu sbalení Proteiny mohou mít podobnou prostorovou strukturu a nemusí mít (na první pohled) podobnou sekvenci. triosafosfátisomerasa 7TIM Aldolasa 3d0c TIM ARTFFVGGNFKLNGSKQSIKEIVERLNTASIPENVEVVICPPATYLDYSVSLVKKPQVTV aldo MSLDYGEFSKRF STISG TIM GAQNAYLKASGAFTG ENSVDQIKDVGAKWVILGHSERRSY FHEDDKFIADKTKFA aldo INIVPFLEGTREIDWKGLDDNVEFLLQNGIEVIVPNGNTGEFYALTIEEAKQVATRVTEL TIM LGQGVGVILCIGETLEEKKAGKTLDVVERQLNAVLEEVKDWTNVVVAYEPVWAIGTGLAA aldo VNGRATVVAGIGYS VDTAIELGKSAID SGADCVMIHQP VHPYI TIM TPEDAQDIHASIRKFLASKL GDKAASELR ILYGGSANGSNAVTF aldo TDAGAVEYYRNIIEALDAPSIIYFKDAHLSDDVIKELAPLDKLVGIKY AINDIQRVTQ TIM KDKADVDGFLVGGASLKPEFVDIINSRN aldo VMRAVPKSSNVAFICGTAEKWAPFFYHAGAVGFTSGLVNVFPQKSFALLEALEEGNQEKI 12 % identity

21 Identifikace způsobu sbalení Proteiny mohou mít podobnou prostorovou strukturu a nemusí mít (na první pohled) podobnou sekvenci. PHYRE2 Fold Recognition - UCLA-DOE I-TASSER

22 Ab initio, de novo Nativní struktura proteinu má vlastnosti, které jí odlišují od ostatních struktur. FoldIT

23 Simulace sbalování proteinu Nativní struktura je minimem volné energie proteinu. K. Lindorff-Larsen, S. Piana, R.O. Dror, D.E.Shaw: How Fast-Folding Proteins Fold. Science 2011, 334(6055)

24 Simulace sbalování proteinu Nativní struktura je minimem volné energie proteinu. VIDEO

25 CASP Critical Assessment of protein Structure Prediction

26 CASP Critical Assessment of protein Structure Prediction

PDB File Format. PDB Format Guide

PDB File Format. PDB Format Guide PDB File Format PDB Format Guide 1 PDB File Format PDB File Format 2 PyMOL.. open-source, user-sponsored, molecular visualization system created by Warren Lyford DeLano and commercialized by DeLano Scientific

Více

Využití strojového učení k identifikaci protein-ligand aktivních míst

Využití strojového učení k identifikaci protein-ligand aktivních míst Využití strojového učení k identifikaci protein-ligand aktivních míst David Hoksza, Radoslav Krivák SIRET Research Group Katedra softwarového inženýrství, Matematicko-fyzikální fakulta Karlova Univerzita

Více

OPVK CZ.1.07/2.2.00/28.0184

OPVK CZ.1.07/2.2.00/28.0184 OPVK CZ.1.07/2.2.00/28.0184 Drug-design - racionální návrh léčiv KFC/DD 03 molekulární cíl RNDr. Karel Berka, Ph.D. ZS 2012/2013 Motto Bez cíle se ani Robin Hood netrefí. Nejmenovaný autor tohoto kurzu

Více

Vytvoření pokročilé Fotogalerie v Drupalu - Views

Vytvoření pokročilé Fotogalerie v Drupalu - Views Vytvoření pokročilé Fotogalerie v Drupalu - Views Views Máme tři pohledy: gallery_photos, all_galeries, admin_gallery Buď je můžete vytvořit podle návodu níže, nebo importovat z přiložených txt souborů

Více

Souhrn výsledků 7. zasedání zastupitelstva města konaného dne 23. 06. 2015

Souhrn výsledků 7. zasedání zastupitelstva města konaného dne 23. 06. 2015 M ě s t o Š e n o v okres Ostrava - město Souhrn výsledků 7. zasedání zastupitelstva města konaného dne 23. 06. 2015 Zastupitelstvo města: a) bere na vědomí: 1. Kontrolu usnesení z minulých zasedání splněny

Více

= 8 25 + 19 12 = 32 43 32 = 11. 2 : 1 k > 0. x k + (1 x) 4k = 2k x + 4 4x = 2 x = 2 3. 1 x = 3 1 2 = 2 : 1.

= 8 25 + 19 12 = 32 43 32 = 11. 2 : 1 k > 0. x k + (1 x) 4k = 2k x + 4 4x = 2 x = 2 3. 1 x = 3 1 2 = 2 : 1. 4 4 = 8 8 8 = 5 + 19 1 = 4 = 11 : 1 k > 0 k 4k x 1 x x k + (1 x) 4k = k x + 4 4x = x = x 1 x = 1 = : 1. v h h s 75 v 50 h s v v 50 s h 75 180 v h 90 v 50 h 180 90 50 = 40 s 65 v 80 60 80 80 65 v 50 s 50

Více

Big Data. Josef Šlerka, Ataxo Interactive, SNM FF UK Business & Information Forum 2011, Praha

Big Data. Josef Šlerka, Ataxo Interactive, SNM FF UK Business & Information Forum 2011, Praha Big Data Josef Šlerka, Ataxo Interactive, SNM FF UK Business & Information Forum 2011, Praha 3 000 000 000 počet hledání na Googlu denně 30 000 000 000 počet zpráv a příspěvků na Facebooku měsíčně 5 000

Více

První krůčky se SAS Enterprise Miner 6.2. Zaškrtněte Personal Workstation a přihlašte se jako localhost\sasdemo.

První krůčky se SAS Enterprise Miner 6.2. Zaškrtněte Personal Workstation a přihlašte se jako localhost\sasdemo. Zaškrtněte Personal Workstation a přihlašte se jako localhost\sasdemo. New Project Pojmenujte projekt a vyberte fyzickou cestu adresář na disku (s právem zápisu pro uživatele sasdemo), kde budou uložena

Více

Možnosti využití technologie DNA microarrays v predikci odpovědi na neoadjuvantní terapii u pacientů s karcinomem jícnu

Možnosti využití technologie DNA microarrays v predikci odpovědi na neoadjuvantní terapii u pacientů s karcinomem jícnu Možnosti využití technologie DNA microarrays v predikci odpovědi na neoadjuvantní terapii u pacientů s karcinomem jícnu Srovnal J. 1, Cincibuch J. 2, Cwierkta K. 2, Melichar B. 2, Aujeský R. 3, Vrba R.

Více

Výukový materiál zpracován v rámci projektu EU peníze školám Registrační číslo projektu: CZ.1.07/1.5.00/34.0996

Výukový materiál zpracován v rámci projektu EU peníze školám Registrační číslo projektu: CZ.1.07/1.5.00/34.0996 Výukový materiál zpracován v rámci projektu EU peníze školám Registrační číslo projektu: CZ.1.07/1.5.00/34.0996 Šablona: III/2 č. materiálu: VY_32_INOVACE_CHE_413 Jméno autora: Mgr. Alena Krejčíková Třída/ročník:

Více

S M L O U V A o smlouvě budoucí o zřízení věcných břemen dle ustanovení 50a Občanského zákoníku (dále jen budoucí smlouva)

S M L O U V A o smlouvě budoucí o zřízení věcných břemen dle ustanovení 50a Občanského zákoníku (dále jen budoucí smlouva) S M L O U V A o smlouvě budoucí o zřízení věcných břemen dle ustanovení 50a Občanského zákoníku (dále jen budoucí smlouva) I. Budoucí smluvní strany Městská část Praha - Běchovice se sídlem Českobrodská

Více

Lodish et al, Molecular Cell Biology, 4-6 vydání Alberts et al, Molecular Biology of the Cell, 4 vydání

Lodish et al, Molecular Cell Biology, 4-6 vydání Alberts et al, Molecular Biology of the Cell, 4 vydání Lodish et al, Molecular Cell Biology, 4-6 vydání Alberts et al, Molecular Biology of the Cell, 4 vydání http://web.natur.cuni.cz/~zdenap/zdenateachingnf.html CHEMICKÉ SLOŽENÍ BUŇKY BUŇKA: 99 % C, H, N,

Více

egon v České republice

egon v České republice egon v České republice verze 2012 Aleš Kučera Novell-Praha akucera@novell.cz egon v ČR, verze 2012 Build 2007.03.38 Czech POINT Build 2009.07.01 Informační systém datových schránek Build 2011.11.29 Novela

Více

její základní velikost je třetina stupně písma (třetina čtverčíku) čtverčík čtverec o straně velikosti kuželky mezera na čtverčík ⅓čtverčíku

její základní velikost je třetina stupně písma (třetina čtverčíku) čtverčík čtverec o straně velikosti kuželky mezera na čtverčík ⅓čtverčíku 1. Učíme se správně psát skládáme slova zarovnání psaní znamének dělení slov hladká sazba Skládáme slova mezislovní mezera vzdálenost mezi slovy; její základní velikost je třetina stupně písma (třetina

Více

Interakce proteinu p53 s genomovou DNA v kontextu chromatinu glioblastoma buněk

Interakce proteinu p53 s genomovou DNA v kontextu chromatinu glioblastoma buněk MASARYKOVA UNIVERZITA V BRNĚ Přírodovědecká fakulta Ústav experimentální biologie Oddělení genetiky a molekulární biologie Interakce proteinu p53 s genomovou DNA v kontextu chromatinu glioblastoma buněk

Více

Návod k aplikaci JanDat v.2.3

Návod k aplikaci JanDat v.2.3 Návod k aplikaci JanDat v.2.3 Petr Pala Jiří Chroust Copyright 2007 CENIA, laboratoř GIS 1. Úvod 2. Části aplikace 2.1. Menu 2.1.1. File 2.1.2. Record 2.1.3. Header 2.1.4. Tools 2.1.5. Languages 2.1.6.

Více

VÝZNAM REGULACE APOPTÓZY V MEDICÍNĚ

VÝZNAM REGULACE APOPTÓZY V MEDICÍNĚ REGULACE APOPTÓZY 1 VÝZNAM REGULACE APOPTÓZY V MEDICÍNĚ Příklad: Regulace apoptózy: protein p53 je klíčová molekula regulace buněčného cyklu a regulace apoptózy Onemocnění: více než polovina (70-75%) nádorů

Více

Uvádění pixelového detektoru experimentu ATLAS do provozu

Uvádění pixelového detektoru experimentu ATLAS do provozu Seminář ATLAS FZU AV ČR 28/3/2008 Uvádění pixelového detektoru experimentu ATLAS do provozu Pavel Jež FZU AVČR, v.v.i. FJFI ČVUT Pixelový detektor status Hlavní rozcestník: https://twiki.cern.ch/twiki/bin/

Více

Direct emailing na míru Emailing podle kategorií Traffic pro váš web Databáze firem SMS kampaně Propagace přes slevový portál Facebook marketing

Direct emailing na míru Emailing podle kategorií Traffic pro váš web Databáze firem SMS kampaně Propagace přes slevový portál Facebook marketing I N T E R N E T O V Ý M A R K E T I N G e f e k t i v n í a c í l e n ý m a r k e t i n g p r o f e s i o n á l n í e m a i l i n g š p i č k o v é t e c h n i c k é z á z e m í p r o p r a c o v a n é

Více

FiberGuardian Krátkodobý monitoring optických vláken

FiberGuardian Krátkodobý monitoring optických vláken FiberGuardian Krátkodobý monitoring optických vláken Pavel Kosour info@profiber.eu www.profiber.eu 1 Princip dohledu optických vláken 2 Fiber Test InSight - Detekce a lokalizace poruch 3 Cable Template

Více

Tvorba aplikací v Oracle Application Express

Tvorba aplikací v Oracle Application Express DBS 4. ročník APEX Tvorba aplikací v Oracle Application Express Cílem této lekce je vytvořit kompletní aplikaci v Apexu, postavenou na vzorových tabulkách společnosti Oracle. Postup: 1. Otevřete lekci

Více

Návrh a prototypová implementace databáze pro

Návrh a prototypová implementace databáze pro Návrh a prototypová implementace databáze pro snadnější práci se strukturami nukleových kyselin Bc. Ondřej Čečák Fakulta elektrotechnická České vysoké učení technické v Praze 10. června 2011 10. června

Více

PDR3MS 1 KANÁLOVÉ MINI DVR UŽIVATELSKÝ NÁVOD

PDR3MS 1 KANÁLOVÉ MINI DVR UŽIVATELSKÝ NÁVOD 1 KANÁLOVÉ MINI DVR UŽIVATELSKÝ NÁVOD (REV 1.0) OBSAH Obsah...1 Zapojení...2 Dálkový ovladač...4 Instalace paměťové karty...5 Vstup do menu...5 Hlavní menu...6 Záznam...6 Kvalita záznamu...7 Nastavení

Více

Jan Forman Manuál 30.5.2013. CLASSIFICATIO N: public / veřejný dokument IDE NTIFICATIO N N U MBER: 0000000000001 AUTH OR:

Jan Forman Manuál 30.5.2013. CLASSIFICATIO N: public / veřejný dokument IDE NTIFICATIO N N U MBER: 0000000000001 AUTH OR: CLASSIFICATIO N: public / veřejný dokument TITLE: Manuál k webovému rozhraní hostingu P ub l i c URL: http://janforman.org/files/webhosting.pdf OFFICE NAME AND ADDRESS: --- IDE NTIFICATIO N N U MBER: 0000000000001

Více

tohoto systému. Můžeme propojit Mathcad s dalšími aplikacemi, jako je Excel, MATLAB, Axum, nebo dokumenty jedné aplikace navzájem.

tohoto systému. Můžeme propojit Mathcad s dalšími aplikacemi, jako je Excel, MATLAB, Axum, nebo dokumenty jedné aplikace navzájem. 83 14. (Pouze u verze Mathcad Professional) je prostředí pro přehlednou integraci a propojování aplikací a zdrojů dat. Umožní vytvořit složitý výpočtový systém a řídit tok dat mezi komponentami tohoto

Více

Š Ě É ě ě ů ď č ě ě Č Á č ě ě ě é ě é ř ů č ě ý ř ů ě é ř é é ř ú č é ý é ů é č ř ě Ť ů ý ý ů č ě ď é ě ý é é é ř ď ý ř ť ř é ě ň ť č ďě č ě ý é č ě ř ň ů ě ř ě ě ě é ů é é č ě ů é č ě é ě ď č ý ě ů ů

Více

Usnesení z 19. schůze Rady města Bechyně konané dne 24. 7. 2013 (usnesení č. 233-255)

Usnesení z 19. schůze Rady města Bechyně konané dne 24. 7. 2013 (usnesení č. 233-255) Usnesení z 19. schůze Rady města Bechyně konané dne 24. 7. 2013 (usnesení č. 233-255) USNESENÍ č. 233/19-13 R přidělit byt č. 115 o velikosti 2+0 I. kat. v přízemí domu s pečovatelskou službou v Bechyni,

Více

PLANAR - měřící servisní technika a monitoring zpětných směrů

PLANAR - měřící servisní technika a monitoring zpětných směrů PLANAR Multifunkční měřící přístroj a monitoring zpětných směrů Jiří Göllner, PROFiber Networking CZ s.r.o. info@profiber.eu www.profiber.eu PLANAR - měřící servisní technika a monitoring zpětných směrů

Více

Návod pro klienty Home Creditu k založení účtu na PayPal

Návod pro klienty Home Creditu k založení účtu na PayPal Návod pro klienty Home Creditu k založení účtu na PayPal Otevřete si svůj internetový prohlížeč. Nejčastěji to je Internet Explorer, Firefox nebo Opera. Do adresního řádku napište www.paypal.com. Stránka

Více

š Á š š ů š ý š Č Š Č ň ý ž ů ý ž ů Č ý ž ú Ň Š Í š ý ú ý š š š ý š š š š ý š š š Ů š š š š ý ů ů š ý ň š š š ž ů ň š ž ž ň ý ž š ý ý š ý š ý ú ů ž ý š ž š ú ú š ý ň ň š ý š š š Ú ú š ý ů š š š š š š š

Více

nastavení real-time PCR cykléru icycler iq5 Multi-Color Real-Time PCR Detection System

nastavení real-time PCR cykléru icycler iq5 Multi-Color Real-Time PCR Detection System Verze: 1.0 Datum poslední revize: 2.1.2014 nastavení real-time PCR cykléru icycler iq5 Multi-Color Real-Time PCR Detection System (BioRad) generi biotech OBSAH: 1. Spuštění již existujícího či nastavení

Více

BDVR HD IR. Návod na použití

BDVR HD IR. Návod na použití Vážený zákazníku, děkujeme Vám za zakoupení přenosného záznamového zařízení DVR. Před použitím si pozorně přečtěte tento návod na použití. Popis zařízení 3 1) HDMI konektor 2) USB konektor 3) Konektor

Více

Vyhledávání v citační databázi Web of Science (WOS)

Vyhledávání v citační databázi Web of Science (WOS) Vyhledávání v citační databázi Web of Science (WOS) Petr Boldiš Stanislava Kohoutová Česká zemědělská univerzita v Praze Studijní a informační centrum 2004 Tento materiál byl vytvořen v rámci grantu FRVŠ

Více

Bioinformatika. hledání významu biologických dat. Marian Novotný. Friday, April 24, 15

Bioinformatika. hledání významu biologických dat. Marian Novotný. Friday, April 24, 15 Bioinformatika hledání významu biologických dat Marian Novotný Bioinformatika sběr biologických dat archivace biologických dat organizace biologických dat interpretace biologických dat 2 Biologové sbírají

Více

České vysoké učení technické v Praze Fakulta jaderná a fyzikálně inženýrská BAKALÁŘSKÁ PRÁCE. 2012 Jan Novák. Titulní strana (vnější desky)

České vysoké učení technické v Praze Fakulta jaderná a fyzikálně inženýrská BAKALÁŘSKÁ PRÁCE. 2012 Jan Novák. Titulní strana (vnější desky) České vysoké učení technické v Praze Fakulta jaderná a fyzikálně inženýrská BAKALÁŘSKÁ PRÁCE 2012 Jan Novák Titulní strana (vnější desky) České vysoké učení technické v Praze Fakulta jaderná a fyzikálně

Více

Obchodní akademie a Jazyková škola s právem státní jazykové zkoušky Jihlava

Obchodní akademie a Jazyková škola s právem státní jazykové zkoušky Jihlava Obchodní akademie a Jazyková škola s právem státní jazykové zkoušky Jihlava Šablona 32 VY_32_INOVACE_033.ICT.34 Tvorba webových stránek MS Visual Studio 2010 - HTML Číslo projektu: CZ.1.07/1.5.00/34.0744

Více

Změna vlastností kódem

Změna vlastností kódem Změna vlastností kódem - Metoda setjménovlastnosti(hodnota); - Zadání úkolu Změna vlastností kódem Práce s vlastnostmi Metody setxxx nastavení vlastnosti Metody getxxx zjištění hodnoty vlastnosti případně

Více

INTERNÍ NORMY VYDÁVÁ KANCELÁŘ AV ČR PRO POTŘEBU AV ČR

INTERNÍ NORMY VYDÁVÁ KANCELÁŘ AV ČR PRO POTŘEBU AV ČR INTERNÍ NORMY VYDÁVÁ KANCELÁŘ AV ČR PRO POTŘEBU AV ČR Částka 3/2015 URL: http://interni.avcr.cz/dokumenty/interni_normy/ Obsah: Směrnice Akademické rady AV ČR - Pravidla pro udělování vědeckého titulu

Více

á ář á ř ř Č ř áč ě řá ú á ř č á á á á á ú ů ř ř Č á ř á á á Š ž č ě ř č ý ů á á ř ř ú á ř ž ý ý á á ž á ř č ů á á ů ř ý ý áš á ěř á ž á á ěř á á ř ž á ě ě á á žá á ů ý ř žá ř ě č ě á ě á ř ž ú ů ř ř ž

Více

24. schůze Rady městského obvodu Svinov, konané dne 22.6.2015

24. schůze Rady městského obvodu Svinov, konané dne 22.6.2015 24. schůze Rady městského obvodu Svinov, konané dne 22.6.2015 359/24/15 381/24/15 Mgr. Lenka Hrušková starostka Ing. Helena Wieluchová místostarostka 359/24/15 M. č. 0 s c h v a l u j e program 24. schůze

Více

Obsah: Bezpečnost... 2. Vybavení... 2. Vlastnosti... 3. Popis a funkce... 4. Pracovní postupy. 5.1. Nastavení... 6. 5.2. Záznam teploty...

Obsah: Bezpečnost... 2. Vybavení... 2. Vlastnosti... 3. Popis a funkce... 4. Pracovní postupy. 5.1. Nastavení... 6. 5.2. Záznam teploty... Obsah: Bezpečnost... 2 Vybavení... 2 Vlastnosti... 3 Popis a funkce... 4 Pracovní postupy 5.1. Nastavení... 6 5.2. Záznam teploty... 8 5.3. Vymazat paměť... 9 5.4. Stáhnout paměť... 9 5.5. Výměna baterií...

Více

Metody tvorby ontologií a sémantický web. Martin Malčík, Rostislav Miarka

Metody tvorby ontologií a sémantický web. Martin Malčík, Rostislav Miarka Metody tvorby ontologií a sémantický web Martin Malčík, Rostislav Miarka Obsah Reprezentace znalostí Ontologie a sémantický web Tvorba ontologií Hierarchie znalostí (D.R.Tobin) Data jakékoliv znakové řetězce

Více

Národní centrum pro výzkum biomolekul & MetaCentrum

Národní centrum pro výzkum biomolekul & MetaCentrum Masarykova Univerzita Národní centrum pro výzkum biomolekul Národní centrum pro výzkum biomolekul & Petr Kulhánek kulhanek@chemi.muni.cz Národní centrum pro výzkum biomolekul, Masarykova Univerzita Přírodovědecká

Více

Rikomagic MK902 II. Uživatelská příručka CZ

Rikomagic MK902 II. Uživatelská příručka CZ Rikomagic MK902 II Uživatelská příručka CZ Děkujeme Vám za zakoupení Rikomagic MK902 II MK902 II je revoluční TV Box na bázi Android 4.4 KitKat s čtyřjádrovým procesorem RK3288 a grafikou Mali T764. S

Více

OPVK CZ.1.07/2.2.00/28.0184

OPVK CZ.1.07/2.2.00/28.0184 OPVK CZ.1.07/2.2.00/28.0184 Drug-design - racionální návrh léčiv KFC/DD 02 co dělá léčivo léčivem RNDr. Karel Berka, Ph.D. ZS 2012/2013 Motto Q: What make compound a good drug? A: What? Give it to the

Více

CCD 90 MV Cameras (Firewire) CCD 90 MV Cameras (GigE) CCD 90 MV Cameras (USB 2.0)

CCD 90 MV Cameras (Firewire) CCD 90 MV Cameras (GigE) CCD 90 MV Cameras (USB 2.0) CCD 90 MV Cameras (Firewire) PL-B952F-R PL-B953F-R PL-B954F-R PL-B954HF-R PL-B955F-R PL-B955HF-R PL-B956F-R PL-B957F-R PL-B958F-R PL-B959F-R CCD 90 MV Cameras (GigE) PL-B954G-R PL-B954HG-R PL-B955G-R PL-B955HG-R

Více

Chemické formáty. Bedřich Košata

Chemické formáty. Bedřich Košata Chemické formáty Bedřich Košata SMILES Simplified Molecular Input Line Entry Specification Navržen pro použití lidmi Podobná normálnímu zápisu chemických struktur Umožňuje ale nevyžaduje kanonickou formu

Více

INTERSTENO 2013Ghent Mistrovstvísvta v profesionálním word processingu

INTERSTENO 2013Ghent Mistrovstvísvta v profesionálním word processingu POUŽITÝ OPERAČNÍ SYSTÉM POUŽITÝ SOFTWARE PRO WORD PROCESSING SOUTĚŽNÍ ID A 1 Instrukce pro účastníky Otevřete dokument TRANSPORT.DOC, ihned uložte jako TRANSPORTXXX.DOCneboDOCX,kde XXX je Vašesoutěžní

Více

č é č ě ší Ž ý ý ší ů í č á č í á ž á žň ř ě ší í ě ě ý ří é á í é ý í ší á á í ě á Ž ú ě ý ů á í č ý ž á á í ů Č š á é é é á ě á ř ý ž á í ž ě á í éč ž ě š ý é č í í ů ří é é ý ž á é í é í á á í é ě é

Více

Vstupní požadavky, doporučení a metodické pokyny

Vstupní požadavky, doporučení a metodické pokyny Název modulu: Grafika v OSS/FS Označení: B5 Stručná charakteristika modulu Modul je orientován na tvorbu a zpracování rastrové a vektorové grafiky v prostředí otevřeného a svobodného software. Zahrnuje

Více

Thursday, February 27, 14

Thursday, February 27, 14 DATABÁZE A VYHLEDÁVÁNÍ SEKVENCÍ MOLEKULÁRNÍ TAXONOMIE 2014 MARIAN NOVOTNÝ PŘEDNÁŠEJÍCÍ Mgr. Marian NOVOTNÝ, PhD. vystudoval odbornou biologii na PřF UK, diplomka v laboratoři doc. Folka doktorát na Uppsalské

Více

POSTUP PŘI NASTAVENÍ OVLÁDACÍHO PANELU S DOTYKOVÝM DISPLEJEM JAK PŘEJÍT DO SPRÁVCE NASTAVENÍ

POSTUP PŘI NASTAVENÍ OVLÁDACÍHO PANELU S DOTYKOVÝM DISPLEJEM JAK PŘEJÍT DO SPRÁVCE NASTAVENÍ POSTUP PŘI NASTAVENÍ OVLÁDACÍHO PANELU S DOTYKOVÝM DISPLEJEM JAK PŘEJÍT DO SPRÁVCE NASTAVENÍ Trojúhelníkové heslo: pro vstup do nastavení poklepejte na oblasti 1, 2 a 3. SPRÁVCE NASTAVENÍ (ADMINISTRATOR

Více

Testovací SSL certifikát RapidSSL

Testovací SSL certifikát RapidSSL Testovací SSL certifikát RapidSSL Připravili jsme pro Vás podrobný návod, jak si ZDARMA vytvořit testovací SSL certifikát RapidSSL a vyzkoušet si jeho plnou funkčnost po dobu 30 dní. Aktuální ceny, objednávky

Více

Vzorový příklad. Postup v prostředí ISE. Zadání: x 1 x 0 y. Rovnicí y = x 1. x 0. Přiřazení signálů: ČESKÉ VYSOKÉ UČENÍ TECHNICKÉ V PRAZE

Vzorový příklad. Postup v prostředí ISE. Zadání: x 1 x 0 y. Rovnicí y = x 1. x 0. Přiřazení signálů: ČESKÉ VYSOKÉ UČENÍ TECHNICKÉ V PRAZE Vzorový příklad. Zadání: Na přípravku realizujte kombinační obvod představující funkci logického součinu dvou vstupů. Mající následující pravdivostní tabulku. x 1 x 0 y 0 0 0 0 1 0 1 0 0 1 1 1 Rovnicí

Více

www.disney.cz Rozšiřte své možnosti ONLINE

www.disney.cz Rozšiřte své možnosti ONLINE www.disney.cz Rozšiřte své možnosti ONLINE Prezentace webových stránek Disney Channel Děti milují INTERAKTIVITU Co je www.disney.cz? jediné místo, kde děti a rodiče naleznou ty nejžhavější novinky z DISNEY

Více

Stolní počítač. Mobilní telefon. Síť. Skladování léků. Monitorování chlazení. Monitorování mražení. Monitoring skladování. Software Winlog.

Stolní počítač. Mobilní telefon. Síť. Skladování léků. Monitorování chlazení. Monitorování mražení. Monitoring skladování. Software Winlog. Skladování léků Monitorování chlazení Stolní počítač Mobilní telefon Monitorování mražení Síť Monitoring skladování EBI 25-T / / Vysoká přesnost měření teploty / vlhkosti Ukládání sledovaných dat i v případě

Více

Identity and Access Management

Identity and Access Management Identity and Access Management Praktické cvičení pavel.horal@orchitech.cz Cíl cvičení Identity & Access Management Identity Management Část IdM Seznámení s OpenIDM Načtení HR exportu Synchronizace do LDAPu

Více

Infračervený Digitální fotoaparát fotopast Uživatelská příručka Kapesní fotoaparát řady SG370 Model: SG370B / SG370VB

Infračervený Digitální fotoaparát fotopast Uživatelská příručka Kapesní fotoaparát řady SG370 Model: SG370B / SG370VB Infračervený Digitální fotoaparát fotopast Uživatelská příručka Kapesní fotoaparát řady SG370 Model: SG370B / SG370VB Obsah 1 Úvod 1.1 Všeobecný popis 1.2 Tělo fotoaparátu, rozhraní 1.3 Zobrazení informací

Více

- 0205/RMOb-Mich/1418/16

- 0205/RMOb-Mich/1418/16 16. schůze rady městského obvodu konané dne 15.06.2015 čís. 0186/RMOb-Mich/1418/16-0205/RMOb-Mich/1418/16 Ing. Martin Juroška, Ph.D. starosta Ing. Vladimír Kozel místostarosta Strana 1/11 Přehled usnesení

Více

Název: VY_32_INOVACE_PG3314 Rendering - vykreslení vytvořené scény. Vzdělávací oblast / téma: 3D grafika, počítačová grafika, 3DS Max

Název: VY_32_INOVACE_PG3314 Rendering - vykreslení vytvořené scény. Vzdělávací oblast / téma: 3D grafika, počítačová grafika, 3DS Max Název: VY_32_INOVACE_PG3314 Rendering - vykreslení vytvořené scény Autor: Mgr. Tomáš Javorský Datum vytvoření: 05 / 2012 Ročník: 3 Vzdělávací oblast / téma: 3D grafika, počítačová grafika, 3DS Max Anotace:

Více

Obsah Použití exe... 3 Nastavení projektu... 4

Obsah Použití exe... 3 Nastavení projektu... 4 exe Minimanuál Obsah Použití exe... 3 Nastavení projektu.... 4 Vyplnění informací o projektu.... 4 Definice struktury... 4 Styly / Šablony... 5 Uložení projektu... 5 Export projektu.... 5 Import Projektu

Více

Superpočítání a gridové počítání

Superpočítání a gridové počítání Superpočítáníagridovépočítání MartinPetřek,1,2PetrKulhánek,1,2 JanKmuníček1,3 petrek@chemi.muni.cz,kulhanek@chemi.muni.cz,kmunicek@ics.muni.cz 1)CESNETz.s.p.o.,Zikova4,CZ 16000Praha,Českárepublika 2)Národnícentrumprovýzkumbiomolekul,PřírodovědeckáFakulta,Masarykovauniverzita,

Více

Využití synchrotronového záření pro diagnostiku a vývoj nových léčiv

Využití synchrotronového záření pro diagnostiku a vývoj nových léčiv Využití synchrotronového záření pro diagnostiku a vývoj nových léčiv J.Hašek, ÚMCH AV ČR Zisky farmaceutických společností a společností využívajících biotechnologie činící mnoha miliard dolarů ročně jsou

Více

IP Kamery RELICAM Verze 1 UŽIVATELSKÝ MANUÁL

IP Kamery RELICAM Verze 1 UŽIVATELSKÝ MANUÁL IP Kamery RELICAM Verze 1 UŽIVATELSKÝ MANUÁL Pro ovládací rozhraní kamer Sérií RC-ID10xF RC-IW10xF RC-ID10xV RC-IW10xV RC-ID20xV RC-IW20xV Důležité upozornění: Informace o nastavení operačních systémů

Více

Gymnázium a Střední odborná škola, Rokycany, Mládežníků 1115

Gymnázium a Střední odborná škola, Rokycany, Mládežníků 1115 Číslo projektu: Číslo šablony: Název materiálu: Gymnázium a Střední odborná škola, Rokycany, Mládežníků 1115 CZ.1.07/1.5.00/34.0410 II/2 Parts of a computer IT English Ročník: Identifikace materiálu: Jméno

Více

Co je nového v aplikaci QuarkXPress 2015

Co je nového v aplikaci QuarkXPress 2015 Co je nového v aplikaci QuarkXPress 2015 OBSAH Obsah Co je nového v aplikaci QuarkXPress 2015...3 Nové funkce...4 64bitová aplikace...4 Proměnné obsahu...4 Tabulky v řádku...5 Poznámky pod čarou a Poznámky

Více

Instalace Pokyny pro instalaci v operačním systému Windows XP / Vista / Win7 / Win8

Instalace Pokyny pro instalaci v operačním systému Windows XP / Vista / Win7 / Win8 Instalace Pokyny pro instalaci v operačním systému Windows XP / Vista / Win7 / Win8 1. Stáhněte si instalační program HOST makro engine z oficiálního webu IABYTE. 2. Spusťte instalační program a postupujte

Více

UML: Unified Modeling Language

UML: Unified Modeling Language UML 1 UML: Unified Modeling Language Systém kombinace softwaru, hardwaru, dat a uživatelů, která umožňuje řešení konkrétního problému Vývoj systémů vytváření systémů pro klienta Vývoj probíhá na základě

Více

Ú ů ěš Š ň š Ú ě ě ě ů ž ý ě Ú ž ý ž ý ů ď š ě ž ů ů ů ýš ě ý ý ů ě š ě ě Š ě ý ě ď ě š ýš ž ě š ěž ěž ů ěš ý ě š ý ý ý ý ý ý ý š š Ř ž ž ě ě ž ý ú ů ů ě ý š ě ě ě ě š š ň ě Č ý ě ěž ž ý ú ů ž ě ě ě ý

Více

Vlákna a internetové protokoly

Vlákna a internetové protokoly Vlákna a internetové protokoly Co to jsou vlákna Vlákna jsou samostatné procesy, které sdílejí stejný adresový prostor. Vlákna jsou na sobě nezávislá. Pokud se stane, že jedno vlákno změní proměnou, ihned

Více

RNA interference (RNAi)

RNA interference (RNAi) Liběchov, 29. 11. 2013 RNA interference (RNAi) post-transkripční umlčení genové exprese přirozený mechanismus regulace genové exprese a genomové stability obranný antivirový mechanismus konzervovaný mechanismus

Více

Postup při zasílání dokumentů smluvních partnerů České pojišťovny prostřednictvím aplikace externí upload

Postup při zasílání dokumentů smluvních partnerů České pojišťovny prostřednictvím aplikace externí upload Postup při zasílání dokumentů smluvních partnerů České pojišťovny prostřednictvím aplikace externí upload Aplikaci spustíte dvojklikem na ikonu s logem ČP Upload zobrazí se následující okno aplikace: Pro

Více

MPSC-3-CS 1 MINI ALUMINIUM COMPUTER 19 987 2.0 GHz Intel Celeron Processor 256MB SDRAM, 40GB Harddrive 3 USB, 1 Fire Wire 12V DC.

MPSC-3-CS 1 MINI ALUMINIUM COMPUTER 19 987 2.0 GHz Intel Celeron Processor 256MB SDRAM, 40GB Harddrive 3 USB, 1 Fire Wire 12V DC. VZOR MALÉ POČÍTAČE DO AUTA Model # MINI ALUMINIUM COMPUTERS. H5 MPSC-3- MINI ALUMINIUM COMPUTER 11 151 Barebone system 3 USB, 1 Fire Wire, No CPU, No Memory. MPSC-3-CS 1 MINI ALUMINIUM COMPUTER 19 987

Více

Inspekce tvaru součásti

Inspekce tvaru součásti Inspekce tvaru součásti. Cílem cvičení je inspekce tvaru součásti spočívající načtení referenčního CAD modelu, v ustavení naskenovaného tvaru vzhledem k tomuto referenčnímu modelu, kontrole průměru spodního

Více

. UNEP Ochrana půd CH 4 N 2 O http://chm.pops.int/home/tabid/2121/mctl/viewdetails/eventmodid/871/ev entid/407/xmid/6921/default.aspx http://www.enviroliteracy.org/subcategory.php/36.html www.amo.cz

Více

ó ó Ě óó Úč ó č ý Á Ř É é ž č č č ý š ů č ý ý Í ý ý é č é é ý ý é é é ž ó č č ó Úč ť ó Ž é ý ý ů é é ů é é č š č ý ý č č č é č ž ž é č č é č č č č č č č č ó ó Ž č É ó Úč ó ž č é ý č é é ž č ýš š é ů ú

Více

Uživatelské příkazy: false - dialog ukončen IDCANCEL. Vytvoří nové okno. title - titulek okna

Uživatelské příkazy: false - dialog ukončen IDCANCEL. Vytvoří nové okno. title - titulek okna Uživatelské příkazy: CMD CRW MDA Popis Vytvoří nové okno Odpověď na požadavek uzavření okna SWT Nastaví titulek okna text MVW Přesune okno na pozici x;y SZW Změní velikost okna width;height style SWP MSB

Více

ý ú Ú Ú ý ý ý Ž ý ý ý ý ý ý ý ý ý ý ý ý ý ý ý Ž ř Á ý ý ý ů Ž ř ý ý ý ý ý ý ý ý ý ý ý ý Ž ý ř ý ý Ž Ů ž Ů ý ř ý ý ó ó Ú Ú Ž ý ý Ů ý ý Ů Á ý ý ý Ú Ý Ý ý Ů ý ů Ž ý ř Ů ý Ž ý ý ý ř ž Ž Ž ř š ň ř ů ř ň ř ř

Více

Software Capture Pro. Začínáme. A-61640_cs

Software Capture Pro. Začínáme. A-61640_cs Software Capture Pro Začínáme A-61640_cs Začínáme se softwarem Kodak Capture Pro Software a Capture Pro Limited Edition Instalace softwaru: Kodak Capture Pro Software a Network Edition... 1 Instalace softwaru:

Více

Elektronická podpora výuky chemie Ing. Tomáš Buriánek burianek@spschbr.cz

Elektronická podpora výuky chemie Ing. Tomáš Buriánek burianek@spschbr.cz Snížení rizik ohrožení zdraví člověka a životního prostředí podporou výuky chemie na ZŠ Elektronická podpora výuky chemie Ing. Tomáš Buriánek burianek@spschbr.cz Obsah Webové stránky věnující se chemii

Více

Nápověda k aplikaci GraphGUI

Nápověda k aplikaci GraphGUI Nápověda k aplikaci GraphGUI 1 APLIKACE Aplikace slouží pro zobrazování závislosti několika veličin s různými jednotkami a rozsahy na čase v jednom grafu. Do aplikace lze importovat data ze souborů různých

Více

DÁLKOVÝ OVLADAČ MAGIC MOTION

DÁLKOVÝ OVLADAČ MAGIC MOTION NÁVOD K OBSLUZE DÁLKOVÝ OVLADAČ MAGIC MOTION Před uvedením zařízení do provozu si pečlivě prostudujte tento návod a uložte jej pro budoucí potřebu. AN-MR200 Dálkový ovladač Magic Motion (AKB732955) Hardwarový

Více

č č č č č č č č č č č č č č č č č č

č č č č č č č č č č č č č č č č č č ř ů š é ě ě ý ů ě ý ů é ý ý ů š é ě é ě ř Í Ž ě ě ž Í ě é Ú ý ě ě š ř ž Íť ř š ě ý ů ý ů š Í ý é š ě ř ú é Í ý É Í ě ě ě ý é ž ý š é Í Š ě š ý Ž é ěě Ž ě Ý Á Ř š ř é ďž é ů ů Í Í Í Í ě řš ě Ž Ť ď Š ě Á

Více

Aminokyseliny, proteiny, enzymologie

Aminokyseliny, proteiny, enzymologie Aminokyseliny, proteiny, enzymologie Aminokyseliny Co to je? Organické látky karboxylové kyseliny, které mají na sousedním uhlíku navázanou aminoskupinu Jak to vypadá? K čemu je to dobré? AK jsou stavební

Více

ý ý ž ž š š ě ě ě ě ě ě ž Á ť ě ý ý ý Ú ý ž š ý ý ž ý ž ý ž Š ě ý ž ý ž Í ý ž ě ž ě ý ú ě ě ý ý ě ě ý ě ú ů ý ž ě ú ú ě ý Ú š ú ů ýš ů ě ú š š ý Ú š ý ě ďě š ú ž Š ě ú Š ě Ť ž ú š ú ž ú ě ě ť ě ý ú ě ž

Více

Návod pro užívání systému CRemko

Návod pro užívání systému CRemko Návod pro užívání systému CRemko Obsah 1 Úvodní stránka 2 Horní lišta 3 Projekty 3.1 Nový projekt 4 Firmy 4.1 Editace firmy 5 Kontakty 5.1 Editace kontaktu 6 Kalendář 6.1 Editace kalendáře 7 Zprávy 7.1

Více

SIM Card Recovery Stick

SIM Card Recovery Stick SIM Card Recovery Stick Návod k použití Hlavní výhody produktu: Jednoduché ovládání Recovery software Obnoví i smazané SMS, které se nacházejí na SIM kartě Možno použít také pro kompletní management vaší

Více

Mezinárodní přehled cen mléka v jednotlivých mlékařských společnostech za prosinec 2008. Cena ( /100 Kg)

Mezinárodní přehled cen mléka v jednotlivých mlékařských společnostech za prosinec 2008. Cena ( /100 Kg) za prosinec 2008 BE 27,46 33,03 DE 28,82 35,16 DE 25,85 31,39 DK 32,36 37,13 FI 46,49 45,40 FR 32,52 35,47 FR 35,13 36,95 FR 32,62 35,27 FR 29,51 35,00 GB 31,85 32,73 GB 28,60 31,03 IE 30,28 33,54 IE 28,85

Více

Abstraktní datové typy: zásobník

Abstraktní datové typy: zásobník Abstraktní datové typy: zásobník doc. Ing. Miroslav Beneš, Ph.D. katedra informatiky FEI VŠB-TUO A-1007 / 597 324 213 http://www.cs.vsb.cz/benes Miroslav.Benes@vsb.cz Abstraktní datové typy omezené rozhraní

Více

Drags imun. Innovations

Drags imun. Innovations Energy news 2 Inovace Innovations 1 Drags imun V příštích plánovaných výrobních šaržích dojde ke změně balení a designu tohoto produktu. Designové změny sledují úspěšný trend započatý novou generací Pentagramu

Více

www.zlinskedumy.cz Pracovní list VY_32_INOVACE_33_19 Databáze Databáze Databáze Ing. Petr Vilímek

www.zlinskedumy.cz Pracovní list VY_32_INOVACE_33_19 Databáze Databáze Databáze Ing. Petr Vilímek VY_32_INOVACE_33_19 Pracovní list Škola Název projektu, reg. č. Vzdělávací oblast Vzdělávací obor Tematický okruh Téma Tematická oblast Střední průmyslová škola Zlín Inovace výuky prostřednictvím ICT v

Více

Šifrování ve Windows. EFS IPSec SSL. - Encrypting File System - Internet Protocol Security - Secure Socket Layer - Private Point to Point Protocol

Šifrování ve Windows. EFS IPSec SSL. - Encrypting File System - Internet Protocol Security - Secure Socket Layer - Private Point to Point Protocol Šifrování ve Windows EFS IPSec SSL PPTP - Encrypting File System - Internet Protocol Security - Secure Socket Layer - Private Point to Point Protocol 18.11.2003 vjj 1 Bezpečnost? co chci chránit? systém

Více

VYUŽITÍ INTERNETOVÝCH DATOVÝCH ZDROJŮ V CESTOVNÍM RUCHU

VYUŽITÍ INTERNETOVÝCH DATOVÝCH ZDROJŮ V CESTOVNÍM RUCHU VYUŽITÍ INTERNETOVÝCH DATOVÝCH ZDROJŮ V CESTOVNÍM RUCHU The use of web data sources in the tourism Ing. Libor Kavka, Ph.D. Vysoká škola logistiky Přerov, Palackého 25, 750 02 Přerov libor.kavka@vslg.cz

Více

Firmadat SMS Sender. aplikace pro odesílání SMS zpráv z Vašeho PC pomocí telefonu ZÁKLADNÍ INFORMACE A INSTALACE MILAN PASTOR, ROMAN NEPŠINSKÝ

Firmadat SMS Sender. aplikace pro odesílání SMS zpráv z Vašeho PC pomocí telefonu ZÁKLADNÍ INFORMACE A INSTALACE MILAN PASTOR, ROMAN NEPŠINSKÝ 2013 Firmadat SMS Sender aplikace pro odesílání SMS zpráv z Vašeho PC pomocí telefonu ZÁKLADNÍ INFORMACE A INSTALACE MILAN PASTOR, ROMAN NEPŠINSKÝ FIRMDAT S.R.O. Havlíčkova 1280,765 02 Otrokovice, tel.:

Více

Příručka uživatele programu

Příručka uživatele programu Příručka uživatele programu QL-500 QL-650TD QL-550 QL-1050/1050N 1 Obsah Obsah..................................................................................... 2.......................................................................................

Více

Mendelova zemědělská a lesnická univerzita v Brně Provozně ekonomická fakulta

Mendelova zemědělská a lesnická univerzita v Brně Provozně ekonomická fakulta Mendelova zemědělská a lesnická univerzita v Brně Provozně ekonomická fakulta Začínáme s BPM Učební pomůcka Autor: Ing. Michael Štencl Brno 2007 OBSAH 2 Obsah 1 Jak přistupovat k BPM 3 2 Prvky BPM 5 2.1

Více

Hlas. Robert Elbl 13.9.2012 COPYRIGHT 2011 ALCATEL-LUCENT ENTERPRISE. ALL RIGHTS RESERVED.

Hlas. Robert Elbl 13.9.2012 COPYRIGHT 2011 ALCATEL-LUCENT ENTERPRISE. ALL RIGHTS RESERVED. Vítáme Vás Hlas Robert Elbl 13.9.2012 COPYRIGHT 2011 ALCATEL-LUCENT ENTERPRISE. ALL RIGHTS RESERVED. AGENDA 1. Alcatel Lucent OmniPCX Enterprise & OmniSwitch IP Touch OmniSwitch 2. Praktická ukázka: Vytvoření

Více