Strukturní biologie. Vojtěch Spiwok.

Rozměr: px
Začít zobrazení ze stránky:

Download "Strukturní biologie. Vojtěch Spiwok. spiwokv@vscht.cz http://web.vscht.cz/spiwokv/modelovani/"

Transkript

1 Strukturní biologie Vojtěch Spiwok

2 Domácí úkol: Instrukce: Vytvořte obrázek prostorové struktury vylosovaného proteinu tak, aby z něj byla dobře patrná interakce proteinové části s ligandem nebo ligandy (kofaktory, inhibitory atd). Obrázek musí mít bílé pozadí. Pro proteinovou část použijte reprezentaci bez zobrazení jednotlivých atomů (např. ribon, cartoon a podobně). Pro neproteinovou část použijte zobrazení jednotlivých atomů (sticks, ball&sticks, spheres atd, ale ne lines). Pokud je to vhodné, je možné stejným způsobem zobrazit i atomy vybraných aminokyselinových zbytků. V případě vícepodjednotkových proteinů je možné zobrazit pouze jednu podjednotku, zvláště pokud se nejedná o biologický oligomer (např. je jejich interakce důsledkem krystalizace). V obrázku je možné popsat jednotlivé podjednotky, ligandy, rezidua a podobně. Pro tyto popisky použijte písmo Helvetica. Celý obrázek musí být ve formátu tiff, na šířku musí mít 6-8 cm a rozlišení 300 dpi. K obrázku připojte krátký popisek. V něm uveďte jaký software byl použit. Vhodný software: PyMol - VMD - UCSF Chimera - nebo jiný

3 Domácí úkol: 1e4v 1ffy 1gal 1ipw 1k22 1n2c 1u70 1upp 1v97 1w4w 1yq2 2fbw 2jhf 2r4f 2vk4 2x91 2xfu 3b7e 3div 3f0t 3g2h 3gzk 3ha1 3hw7 3i9v 3ihj 3jwq 3k4v 3lii 3lxe 3m8r 3maa 3n10 3n8v 3txt 4ake 4ea3 4k5y 4l0d 4l6r 4n6h 4oo9 4or2 8tim

4 Prostorové struktury proteinů

5 Prostorové struktury proteinů 4iy0 HEADER METAL TRANSPORT 28 JAN 13 4IY0 TITLE STRUCTURAL AND LIGAND BINDING PROPERTIES OF THE BATEMAN DOMAIN OF TITLE 2 HUMAN MAGNESIUM TRANSPORTERS CNNM2 AND CNNM4 COMPND MOL_ID: 1; COMPND 2 MOLECULE: METAL TRANSPORTER CNNM2; COMPND 3 CHAIN: A; COMPND 4 FRAGMENT: CBS DOMAIN, UNP RESIDUES ; COMPND 5 SYNONYM: ANCIENT CONSERVED DOMAIN CONTAINING PROTEIN 2, CYCLIN M2; COMPND 6 ENGINEERED: YES SOURCE MOL_ID: 1; SOURCE 2 ORGANISM_SCIENTIFIC: HOMO SAPIENS; SOURCE 3 ORGANISM_COMMON: HUMAN; SOURCE 4 ORGANISM_TAXID: 9606; SOURCE 5 GENE: CNNM2; SOURCE 6 EXPRESSION_SYSTEM: ESCHERICHIA COLI; SOURCE 7 EXPRESSION_SYSTEM_TAXID: 562; SOURCE 8 EXPRESSION_SYSTEM_STRAIN: BL21; SOURCE 9 EXPRESSION_SYSTEM_VECTOR_TYPE: PLASMID; SOURCE 10 EXPRESSION_SYSTEM_PLASMID: PET101D/TOPO KEYWDS CBS, BATEMAN DOMAIN, MAGNESIUM TRANSPORTER, MAGNESIUM SENSOR, KEYWDS 2 CYTOSOL, METAL TRANSPORT EXPDTA X RAY DIFFRACTION AUTHOR M.A.CORRAL RODRIGUEZ,M.STUIVER,J.A.ENCINAR,V.SPIWOK,I.GOMEZ GARCIA, AUTHOR 2 I.OYENARTE,J.ERENO ORBEA,H.TERASHIMA,A.ACCARDI,T.DIERCKS,D.MULLER, AUTHOR 3 L.A.MARTINEZ CRUZ REVDAT 1 05 MAR 14 4IY0 0 JRNL AUTH M.A.CORRAL RODRIGUEZ,M.STUIVER,J.A.ENCINAR,V.SPIWOK, JRNL AUTH 2 I.GOMEZ GARCIA,I.OYENARTE,J.ERENO ORBEA,H.TERASHIMA, JRNL AUTH 3 A.ACCARDI,T.DIERCKS,D.MULLER,L.A.MARTINEZ CRUZ JRNL TITL STRUCTURAL AND LIGAND BINDING PROPERTIES OF THE BATEMAN JRNL TITL 2 DOMAIN OF HUMAN MAGNESIUM TRANSPORTERS CNNM2 AND CNNM4 JRNL REF TO BE PUBLISHED

6 Prostorové struktury proteinů 4iy0 ATOM 1 N LYS A N ATOM 2 CA LYS A C ATOM 3 C LYS A C ATOM 4 O LYS A O ATOM 5 CB LYS A C ATOM 6 CG LYS A C ATOM 7 CD LYS A C ATOM 8 CE LYS A C ATOM 9 NZ LYS A N ATOM 10 N GLU A N ATOM 11 CA GLU A C ATOM 12 C GLU A C ATOM 13 O GLU A O ATOM 14 CB GLU A C... ATOM 1219 CD GLU A C ATOM 1220 OE1 GLU A O ATOM 1221 OE2 GLU A O TER 1222 GLU A 580 HETATM 1223 PB ADP A P HETATM 1224 O1B ADP A O HETATM 1225 O2B ADP A O HETATM 1226 O3B ADP A O HETATM 1227 PA ADP A P HETATM 1228 O1A ADP A O HETATM 1229 O2A ADP A O HETATM 1230 O3A ADP A O HETATM 1231 O5' ADP A O HETATM 1232 C5' ADP A C HETATM 1233 C4' ADP A C HETATM 1234 O4' ADP A O

7 Prostorové struktury proteinů 4iy0 Pymol VMD USCF Chimera https://www.cgl.ucsf.edu/chimera/

8 Předpověď prostorových struktur proteinů 1. Homologní modelování Proteiny s podobnou sekvencí mají (obvykle) podobnou prostorovou strukturu. 2. Identifikace způsobu sbalení Proteiny mohou mít podobnou prostorovou strukturu a nemusí mít (na první pohled) podobnou sekvenci. 3. Ab initio, de novo Nativní struktura proteinu má vlastnosti, které jí odlišují od ostatních struktur. 4. Simulace sbalování proteinu Nativní struktura je minimem volné energie proteinu.

9 Homologní modelování Proteiny s podobnou sekvencí mají (obvykle) podobnou prostorovou strukturu. Abl kinasa 1opl p38 kinasa 1w84 insulinový receptor 1irk

10 Homologní modelování Proteiny s podobnou sekvencí mají (obvykle) podobnou prostorovou strukturu. Abl kinasa 1opl >1OPL pdb, chain A/1 537 MGQQPGKVLGDQRRPSLPALHFIKGAGKRDSSRHGGPHCNVFVEHEALQRPVASDFEPQG LSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCE AQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQR SISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRN KPTVYGVSPNY DKWEMERTDITMKHKLGGGQYGEVYEGVWKKYS LTVAVKTLKE DTM EVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRE CNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRNLAARNCLVGENHLVKVADFGLS R LMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGID LSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISD EVEKELGKENLYFQ >1IRK pdb, chain A/ insulinový receptor VFPSSVFVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNE SASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPE 1irk AENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMT RDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLS NEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPS FP EVSFFHSEENK YGNLLDYLRE CNRQEVNAVVLLY HGDLKSYLRSLRPEAENNPGRPPPTLQEMIQ

11 Homologní modelování Proteiny s podobnou sekvencí mají (obvykle) podobnou prostorovou strukturu. Swiss Model Modeller https://salilab.org/modeller/ Postup: 1. nalezení sekvenčně podobného proteinu (proteinů) se známou prostorovou strukturou (např. BLAST) 2. zarovnání sekvencí (Clustal, NW) 3. vytvoření modelu (modeller) 4. kontrola modelu (Prosa, Verify3D)

12 Modeller Potřebujeme: 1. zarovnání sekvencí 2. struktury templátů 3. instrukce Zarovnání sekvencí Jméno souboru templátu číslo prvního residua číslo posledního residua C; A sample alignment in the PIR format; used in tutorial >P1;5fd1 structurex:5fd1:1 :A:106 :A:ferredoxin:Azotobacter vinelandii: 1.90: 0.19 AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELA EVWPNITEKKDPLPDAEDWDGVKGKLQHLER* >P1;1fdx sequence:1fdx:1 : :54 : :ferredoxin:peptococcus aerogenes: 2.00: 1.00 AYVINDSC IACGACKPECPVNIIQGS IYAIDADSCIDCGSCASVCPVGAPNPED * řetězec posledního residua Jméno modelu řetězec prvního residua

13 Modeller Potřebujeme: 1. zarovnání sekvencí 2. struktury templátů 3. instrukce umístění templátu(ů) Instrukce # Homology modeling by the automodel class from modeller import * # Load standard Modeller classes from modeller.automodel import * # Load the automodel class log.verbose() # request verbose output env = environ() # create a new MODELLER environment to build this model in # directories for input atom files env.io.atom_files_directory = ['.', '../atom_files'] název souboru zarovnání a = automodel(env, alnfile = 'alignment.ali', # alignment filename knowns = '5fd1', # codes of the templates sequence = '1fdx') # code of the target a.starting_model= 1 # index of the first model a.ending_model = 1 # index of the last model # (determines how many models to calculate) a.make() # do the actual homology modeling index posledního modelu název templátu(ů) název modelu

14 Modeller Potřebujeme: 1. zarovnání sekvencí 2. struktury templátů 3. instrukce Vlastní spuštění: python model default.py Vlastní spuštění: mod9.14 model default.py

15 Modeller Co dál? fúzní protein Templát1 XXXXXXXXXXXXXXXXXX Templát2 XXXXXXXXXXXXXXXXXXXXXXX model XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX inzerce Templát1 XXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXX Templát2 XXXXXX model XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX indukované přizpůsobení Templát1 XXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXX Templát2 XXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXX model XXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXX

16 Modeller Co dál? Více řetězců C; A sample alignment in the PIR format; used in tutorial >P1;1XXX structurex:1xxx:1 :A:666 :C:::: XXXXXXXXX... XXXXXXXXXXXXX/ XXX XX... XXX* >P1;model sequence:model:1 :C:::: XXXXXXXXX... XXXX XXXXX/ XXXXXXXXX... XXX*

17 Modeller Co dál allhmodel přidá vodíky # Homology modeling by the automodel class from modeller import * # Load standard Modeller classes from modeller.automodel import * # Load the automodel class log.verbose() # request verbose output env = environ() # create a new MODELLER environment to build this model in # directories for input atom files env.io.atom_files_directory = ['.', '../atom_files'] ('5fd1', '1xxx'), více templátů a = automodel(env, alnfile = 'alignment.ali', # alignment filename knowns = '5fd1', # codes of the templates sequence = '1fdx') # code of the target a.starting_model= 1 # index of the first model a.ending_model = 1 # index of the last model # (determines how many models to calculate) a.make() # do the actual homology modeling modelů

18 Modeller Co dál? Disulfidové můstky # Homology modeling by the automodel class from modeller import * # Load standard Modeller classes from modeller.automodel import * # Load the automodel class # Redefine the special_patches routine to include the additional disulfides # (this routine is empty by default): class MyModel(automodel): def special_patches(self, aln): # A disulfide between residues 8 and 45: self.patch(residue_type='disu', residues=(self.residues['8'], self.residues['45'])) log.verbose() # request verbose output env = environ() # create a new MODELLER environment to build this model in # directories for input atom files env.io.atom_files_directory = ['.', '../atom_files'] a = MyModel(env, alnfile = 'alignment.ali', # alignment filename knowns = '5fd1', # codes of the templates sequence = '1fdx') # code of the target a.starting_model= 1 # index of the first model a.ending_model = 1 # index of the last model # (determines how many models to calculate) a.make() # do the actual homology modeling

19 Modeller Co dál? Vnucení sekundární struktury # Homology modeling by the automodel class from modeller import * # Load standard Modeller classes from modeller.automodel import * # Load the automodel class class MyModel(automodel): def special_restraints(self, aln): rsr = self.restraints at = self.atoms rsr.add(secondary_structure.alpha(self.residue_range('20:', '30:'))) log.verbose() # request verbose output env = environ() # create a new MODELLER environment to build this model in # directories for input atom files env.io.atom_files_directory = ['.', '../atom_files'] a = MyModel(env, alnfile = 'alignment.ali', # alignment filename knowns = '5fd1', # codes of the templates sequence = '1fdx') # code of the target a.starting_model= 1 # index of the first model a.ending_model = 1 # index of the last model # (determines how many models to calculate) a.make() # do the actual homology modeling

20 Identifikace způsobu sbalení Proteiny mohou mít podobnou prostorovou strukturu a nemusí mít (na první pohled) podobnou sekvenci. triosafosfátisomerasa 7TIM Aldolasa 3d0c TIM ARTFFVGGNFKLNGSKQSIKEIVERLNTASIPENVEVVICPPATYLDYSVSLVKKPQVTV aldo MSLDYGEFSKRF STISG TIM GAQNAYLKASGAFTG ENSVDQIKDVGAKWVILGHSERRSY FHEDDKFIADKTKFA aldo INIVPFLEGTREIDWKGLDDNVEFLLQNGIEVIVPNGNTGEFYALTIEEAKQVATRVTEL TIM LGQGVGVILCIGETLEEKKAGKTLDVVERQLNAVLEEVKDWTNVVVAYEPVWAIGTGLAA aldo VNGRATVVAGIGYS VDTAIELGKSAID SGADCVMIHQP VHPYI TIM TPEDAQDIHASIRKFLASKL GDKAASELR ILYGGSANGSNAVTF aldo TDAGAVEYYRNIIEALDAPSIIYFKDAHLSDDVIKELAPLDKLVGIKY AINDIQRVTQ TIM KDKADVDGFLVGGASLKPEFVDIINSRN aldo VMRAVPKSSNVAFICGTAEKWAPFFYHAGAVGFTSGLVNVFPQKSFALLEALEEGNQEKI 12 % identity

21 Identifikace způsobu sbalení Proteiny mohou mít podobnou prostorovou strukturu a nemusí mít (na první pohled) podobnou sekvenci. PHYRE2 Fold Recognition - UCLA-DOE I-TASSER

22 Ab initio, de novo Nativní struktura proteinu má vlastnosti, které jí odlišují od ostatních struktur. FoldIT

23 Simulace sbalování proteinu Nativní struktura je minimem volné energie proteinu. K. Lindorff-Larsen, S. Piana, R.O. Dror, D.E.Shaw: How Fast-Folding Proteins Fold. Science 2011, 334(6055)

24 Simulace sbalování proteinu Nativní struktura je minimem volné energie proteinu. VIDEO

25 CASP Critical Assessment of protein Structure Prediction

26 CASP Critical Assessment of protein Structure Prediction

Bioinformatika a výpočetní biologie KFC/BIN. I. Přehled

Bioinformatika a výpočetní biologie KFC/BIN. I. Přehled Bioinformatika a výpočetní biologie KFC/BIN I. Přehled RNDr. Karel Berka, Ph.D. Univerzita Palackého v Olomouci Definice bioinformatiky (Molecular) bio informatics: bioinformatics is conceptualising biology

Více

Genomické databáze. Shlukování proteinových sekvencí. Ivana Rudolfová. školitel: doc. Ing. Jaroslav Zendulka, CSc.

Genomické databáze. Shlukování proteinových sekvencí. Ivana Rudolfová. školitel: doc. Ing. Jaroslav Zendulka, CSc. Genomické databáze Shlukování proteinových sekvencí Ivana Rudolfová školitel: doc. Ing. Jaroslav Zendulka, CSc. Obsah Proteiny Zdroje dat Predikce struktury proteinů Cíle disertační práce Vstupní data

Více

PDB File Format. PDB Format Guide

PDB File Format. PDB Format Guide PDB File Format PDB Format Guide 1 PDB File Format PDB File Format 2 PyMOL.. open-source, user-sponsored, molecular visualization system created by Warren Lyford DeLano and commercialized by DeLano Scientific

Více

Usnesení 16. zasedání zastupitelstva městského obvodu konaného dne 11.03.2013

Usnesení 16. zasedání zastupitelstva městského obvodu konaného dne 11.03.2013 16. zasedání zastupitelstva městského obvodu konaného dne 11.03.2013 čís. 0313/ZMOb-Vit/1014/16-0340/ZMOb-Vit/1014/16 Petr Dlabal starosta Ing. Leoš Adamík místostarosta Strana 1 Přehled usnesení zastupitelstva

Více

Usnesení 90. mimořádné schůze rady městského obvodu konané dne 27.08.2014. - 4749/RMObM-Sle/1014/90

Usnesení 90. mimořádné schůze rady městského obvodu konané dne 27.08.2014. - 4749/RMObM-Sle/1014/90 90. mimořádné schůze rady městského obvodu konané dne 27.08.2014 čís. 4743/RMObM-Sle/1014/90-4749/RMObM-Sle/1014/90 MUDr. Hana Heráková Místostarostka Radomír Mandok Uvolněný člen rady Strana 1/14 Přehled

Více

Bioinformatika pro PrfUK 2003

Bioinformatika pro PrfUK 2003 Bioinformatika pro PrfUK 2003 Jiří Vondrášek Ústav organické chemie a biochemie vondrasek@uochb.cas.cz Jan Pačes Ústav molekulární genetiky hpaces@img.cas.cz http://bio.img.cas.cz/prfuk2003 What is Bioinformatics?---The

Více

Usnesení 86. schůze rady městského obvodu konané dne 03.07.2013

Usnesení 86. schůze rady městského obvodu konané dne 03.07.2013 86. schůze rady městského obvodu konané dne 03.07.2013 čís. 2470/RMOb-Vit/1014/86-2498/RMOb-Vit/1014/86 Petr Dlabal starosta MUDr. Jindřich Prokop místostarosta Strana 1 Přehled usnesení rady městského

Více

MĚSTSKÁ ČÁST PRAHA 3 Rada městské části U S N E S E N Í

MĚSTSKÁ ČÁST PRAHA 3 Rada městské části U S N E S E N Í č.j.: 176/2015 MĚSTSKÁ ČÁST PRAHA 3 Rada městské části U S N E S E N Í č. 151 ze dne 09.03.2015 Prodej nemovité věci dle zák.č. 89/2012 Sb., Občanský zákoník, v platném znění pronajatých bytových jednotek

Více

- 0331/RMOb-Mich/1418/22

- 0331/RMOb-Mich/1418/22 22. schůze rady městského obvodu konané dne 05.10.2015 čís. 0312/RMOb-Mich/1418/22-0331/RMOb-Mich/1418/22 Ing. Martin Juroška, Ph.D. starosta Ing. Vladimír Kozel místostarosta Strana 1/11 Přehled usnesení

Více

Úvod do datového a procesního modelování pomocí CASE Erwin a BPwin

Úvod do datového a procesního modelování pomocí CASE Erwin a BPwin Úvod do datového a procesního modelování pomocí CASE Erwin a BPwin (nově AllFusion Data Modeller a Process Modeller ) Doc. Ing. B. Miniberger,CSc. BIVŠ Praha 2009 Tvorba datového modelu Identifikace entit

Více

MĚSTSKÁ ČÁST PRAHA 3 Rada městské části U S N E S E N Í

MĚSTSKÁ ČÁST PRAHA 3 Rada městské části U S N E S E N Í č.j.: 153/2015 MĚSTSKÁ ČÁST PRAHA 3 Rada městské části U S N E S E N Í č. 112 ze dne 02.03.2015 Prodej nemovité věci dle zák.č. 89/2012 Sb., Občanský zákoník, v platném znění pronajatých bytových jednotek

Více

MĚSTSKÁ ČÁST PRAHA 3 Zastupitelstvo městské části U S N E S E N Í. č. 490 ze dne 17.06.2014

MĚSTSKÁ ČÁST PRAHA 3 Zastupitelstvo městské části U S N E S E N Í. č. 490 ze dne 17.06.2014 č.j.: 424/2014 MĚSTSKÁ ČÁST PRAHA 3 Zastupitelstvo městské části U S N E S E N Í č. 490 ze dne 17.06.2014 Prodej nemovité věci dle zák. č. 89/2012 Sb., Občanský zákoník, v platném znění - pronajatých bytových

Více

YINSTRUKCE PRO VYPRACOVÁNÍ PŘÍSPĚVKŮ NA KONFERENCI ICT- KI 2005

YINSTRUKCE PRO VYPRACOVÁNÍ PŘÍSPĚVKŮ NA KONFERENCI ICT- KI 2005 <NÁZEV PŘÍSPĚVKU, 14 b., VELKÁ PÍSMENA, TUČNÉ, CENTROVÁNO> YINSTRUKCE PRO VYPRACOVÁNÍ PŘÍSPĚVKŮ NA KONFERENCI ICT- KI 2005 Jméno(a) autora(ů) s tituly Pracoviště

Více

Využití strojového učení k identifikaci protein-ligand aktivních míst

Využití strojového učení k identifikaci protein-ligand aktivních míst Využití strojového učení k identifikaci protein-ligand aktivních míst David Hoksza, Radoslav Krivák SIRET Research Group Katedra softwarového inženýrství, Matematicko-fyzikální fakulta Karlova Univerzita

Více

Řada C55. Pneumatické lineární pohony. Kompaktní válec podle normy ISO 21287

Řada C55. Pneumatické lineární pohony. Kompaktní válec podle normy ISO 21287 Pneumatické lineární pohony Kompaktní válec podle normy ISO 21287 rozměry podle normy ISO 21287 jednoduchá montáž snímačů polohy ze 4 stran, drážky v tělese válce pro upevnění snímačů polohy standardně

Více

VÝZNAM FUNKCE PROTEINŮ V MEDICÍNĚ

VÝZNAM FUNKCE PROTEINŮ V MEDICÍNĚ FUNKCE PROTEINŮ 1 VÝZNAM FUNKCE PROTEINŮ V MEDICÍNĚ Příklad: protein: dystrofin onemocnění: Duchenneova svalová dystrofie 2 3 4 FUNKCE PROTEINŮ: 1. Vztah struktury a funkce proteinů 2. Rodiny proteinů

Více

NÁVOD K OBSLUZE LAN ovladač s relé

NÁVOD K OBSLUZE LAN ovladač s relé NÁVOD K OBSLUZE LAN ovladač s relé 1. Vlastnosti Správa přes WWW nebo SNMP v2. Firmware upgrade přes TFTP Zobrazovaná data v reálném čase bez nutnosti obnovení WWW stránky Ovládání až 5 relé přímo z webového

Více

Kyvné pohony Série 6400. Miniaturní kompaktní suporty Série 6700. Tlumiče nárazu Série 6900

Kyvné pohony Série 6400. Miniaturní kompaktní suporty Série 6700. Tlumiče nárazu Série 6900 Manipulace Série 000 SpA 4050 LURANO (BG) - Italia Via Cascina Barbellina, 0 Tel. 035/49777 Fax 035/49740 035/4974 http://www.pneumaxspa.com CAP. SOC...700.000 I.V. R.E.A. BERGAMO N. 0798 R.E.A. MILANO

Více

Usnesení 12. mimořádné schůze rady městského obvodu konané dne 31.03.2015. - 0437/RMObM-Sle/1418/12

Usnesení 12. mimořádné schůze rady městského obvodu konané dne 31.03.2015. - 0437/RMObM-Sle/1418/12 12. mimořádné schůze rady městského obvodu konané dne 31.03.2015 čís. 0435/RMObM-Sle/1418/12-0437/RMObM-Sle/1418/12 MVDr. Barbora Jelonková v.r. Starostka městského obvodu Ing. Roman Goryczka v.r. Místostarosta

Více

Ing. Ladislav Pyskatý - tajemník Hana Plachá - zapisovatelka. Mgr. Radek Jehlička Mgr. Karel Štrégl

Ing. Ladislav Pyskatý - tajemník Hana Plachá - zapisovatelka. Mgr. Radek Jehlička Mgr. Karel Štrégl 1 Zápis z jednání Rdy měst v Rychnově nd Kněžnou ze dne 13.7.2015 Přítomni: Ing. Jn Skořep Mgr. Jn Drejslová MUDr. Hn Dvořáková JUDr. Miln Novák Ing. Ivn Skřítecká Ing. Ldislv Pysktý - tjemník Hn Plchá

Více

Stručné shrnutí v bodech

Stručné shrnutí v bodech ISDS Instrukce pro vývojáře aplikací třetích stran Nové SSL certifikáty s SHA-256 Aktualizovaná a doplněná verze ze dne 4.8.2015, která nahrazuje verzi 1.1 ze dne 28.7.2015 Předkládá O2 Czech Republic

Více

Semestrální práce z předmětu. Jan Bařtipán / A03043 bartipan@studentes.zcu.cz

Semestrální práce z předmětu. Jan Bařtipán / A03043 bartipan@studentes.zcu.cz Semestrální práce z předmětu KIV/UPA Jan Bařtipán / A03043 bartipan@studentes.zcu.cz Zadání Program přečte ze vstupu dvě čísla v hexadecimálním tvaru a vypíše jejich součet (opět v hexadecimální tvaru).

Více

OPVK CZ.1.07/2.2.00/28.0184

OPVK CZ.1.07/2.2.00/28.0184 OPVK CZ.1.07/2.2.00/28.0184 Drug-design - racionální návrh léčiv KFC/DD 03 molekulární cíl RNDr. Karel Berka, Ph.D. ZS 2012/2013 Motto Bez cíle se ani Robin Hood netrefí. Nejmenovaný autor tohoto kurzu

Více

Struktura a funkce biomakromolekul KBC/BPOL

Struktura a funkce biomakromolekul KBC/BPOL Struktura a funkce biomakromolekul KBC/BPOL 2. Posttranslační modifikace a skládání proteinů Ivo Frébort Biosyntéza proteinů Kovalentní modifikace proteinů Modifikace proteinu může nastat předtím než je

Více

HTT-102 DVB-T HD modulátor

HTT-102 DVB-T HD modulátor HTT-102 DVB-T HD modulátor HTT-101 slouží k převodu nekomprimovaného obrazového a zvukového signálu v digitálním formátu připojeného na rozhraní HDMI na komprimovaný transportní tok MPEG-4 HD (H.264) a

Více

EEG Application for Emotiv

EEG Application for Emotiv 2014 EEG Application for Emotiv MANUÁL Obsah 1 Úvod... 2 2 Spuštění programu... 2 3 Zobrazení dat v reálném čase... 2 3.1 Patient Information... 2 3.2 Recording Information... 3 3.3 Start Recording...

Více

Vytvoření pokročilé Fotogalerie v Drupalu - Views

Vytvoření pokročilé Fotogalerie v Drupalu - Views Vytvoření pokročilé Fotogalerie v Drupalu - Views Views Máme tři pohledy: gallery_photos, all_galeries, admin_gallery Buď je můžete vytvořit podle návodu níže, nebo importovat z přiložených txt souborů

Více

ReatogoXPE, stručný průvodce

ReatogoXPE, stručný průvodce ReatogoXPE, stručný průvodce Autori : Pavel / Craft www.craftcom.net (11.7.2005) Tento návod vás provede vytvořením ReatogoXPE krok za krokem. Nezabývá se žádným nastavováním, jedná se pouze o základní

Více

2D standard pro jízdní doklady ČD, a.s.

2D standard pro jízdní doklady ČD, a.s. 2D standard pro jízdní doklady ČD, a.s. Základní pravidla a popis struktur Odbor informatiky České dráhy, a.s. Dne: 28.5.2012 Verze. 1.00 1. Úvod Dokument popisuje základní pravidla pro sestavení kontrolního

Více

NMR biomakromolekul RCSB PDB. Progr. NMR

NMR biomakromolekul RCSB PDB. Progr. NMR NMR biomakromolekul Typy biomakromolekul a možnosti studia pomocí NMR proteiny a peptidy rozmanité složení, omezení jen velikostí molekul nukleové kyseliny (RNA, DNA) a oligonukleotidy omezení malou rozmanitostí

Více

MĚSTSKÁ ČÁST PRAHA 3 Zastupitelstvo městské části U S N E S E N Í

MĚSTSKÁ ČÁST PRAHA 3 Zastupitelstvo městské části U S N E S E N Í č.j.: 1049/2015 MĚSTSKÁ ČÁST PRAHA 3 Zastupitelstvo městské části U S N E S E N Í č. 158 ze dne 22.12.2015 Prodej nemovité věci dle zák. č. 89/2012 Sb., občanský zákoník, v platném znění - pronajatých

Více

ČÉ Á ŠŤ šť š Č ř ž š ý Š Č Ú š ú š Ž š š š ř ž ž š š š š ý ř š š ů ř š š š š š ú Í ú ř š š ů š š Ž ř ž ů ý Ě É Ú Í Í Š Ě ÍÚ Í š š Ý ý š Ó Č ř ř ř š ř ý ř ž ř š Č Š ÉŽ š Ě Í š Ř Ě Š Ě Á Á ČÁ š ý ž ž š ý

Více

Metody práce s proteinovými komplexy

Metody práce s proteinovými komplexy Metody práce s proteinovými komplexy Zora Nováková, Zdeněk Hodný Proteinové komplexy tvořeny dvěma a více proteiny spojenými nekovalentními vazbami Van der Waalsovy síly vodíkové můstky hydrofobní interakce

Více

= 8 25 + 19 12 = 32 43 32 = 11. 2 : 1 k > 0. x k + (1 x) 4k = 2k x + 4 4x = 2 x = 2 3. 1 x = 3 1 2 = 2 : 1.

= 8 25 + 19 12 = 32 43 32 = 11. 2 : 1 k > 0. x k + (1 x) 4k = 2k x + 4 4x = 2 x = 2 3. 1 x = 3 1 2 = 2 : 1. 4 4 = 8 8 8 = 5 + 19 1 = 4 = 11 : 1 k > 0 k 4k x 1 x x k + (1 x) 4k = k x + 4 4x = x = x 1 x = 1 = : 1. v h h s 75 v 50 h s v v 50 s h 75 180 v h 90 v 50 h 180 90 50 = 40 s 65 v 80 60 80 80 65 v 50 s 50

Více

Modelování webových služeb v UML

Modelování webových služeb v UML Modelování webových služeb v UML Jaromír Šveřepa LBMS, s.r.o. Abstrakt: Tento příspěvek se zaměřuje na praktický postup pro identifikaci potřeby webové služby, modelování způsobu jejího použití, popřípadě

Více

Usnesení z 26. schůze Rady města Bechyně konané dne 23. 10. 2013 (usnesení č. 325-336)

Usnesení z 26. schůze Rady města Bechyně konané dne 23. 10. 2013 (usnesení č. 325-336) Usnesení z 26. schůze Rady města Bechyně konané dne 23. 10. 2013 (usnesení č. 325-336) USNESENÍ č. 325/26-13 R uzavřít s xxxxxxxxxxxxxxxxxxxxxx, nar. xxxxxxxxxxx, novou smlouvu o nájmu bytu č. 4 o velikosti

Více

Blast Rozhraní DeviceNet

Blast Rozhraní DeviceNet Blast Rozhraní DeviceNet Verze: 1.0 27/09/2001 BLAST-E MNU 0030 MANUÁL DNetBlast JKO MEZ CZ s.r.o. ELEKTROPOHONY Oficiální zastoupení firem REEL S.r.l. a EARP s.p.a Hájecká 2 618 00 Brno-Černovice Tel./fax

Více

4. Centrální dogma, rozluštění genetického kódu a zrod molekulární biologie.

4. Centrální dogma, rozluštění genetického kódu a zrod molekulární biologie. 4. Centrální dogma, rozluštění genetického kódu a zrod molekulární biologie. Od genu k proteinu - centrální dogma biologie Geny jsou zakódovány v DNA - Jakým způsobem? - Jak se projevují? Již v roce 1902

Více

Usnesení z 26. schůze Rady města Bechyně konané dne 7. 12. 2015 (usnesení č. 345-359)

Usnesení z 26. schůze Rady města Bechyně konané dne 7. 12. 2015 (usnesení č. 345-359) Usnesení z 26. schůze Rady města Bechyně konané dne 7. 12. 2015 (usnesení č. 345-359) USNESENÍ č. 345/26-15 R I. r o z h o d l a přidělit byt č. 10 o velikosti 2+1 ve třetím podlaží domu čp. 640 v Bechyni

Více

Regulace translace REGULACE TRANSLACE LOKALIZACE BÍLKOVIN V BUŇCE. 4. Lokalizace bílkovin v buňce. 1. Translační aparát. 2.

Regulace translace REGULACE TRANSLACE LOKALIZACE BÍLKOVIN V BUŇCE. 4. Lokalizace bílkovin v buňce. 1. Translační aparát. 2. Regulace translace 1. Translační aparát 2. Translace 3. Bílkoviny a jejich posttranslační modifikace a jejich degradace 5. Translace v mitochondriích a chloroplastech REGULACE TRANSLACE LOKALIZACE BÍLKOVIN

Více

Natural Language Toolkit

Natural Language Toolkit Natural Language Toolkit prezentace do předmětu PA154 Nástroje pro korpusy část 1 možnosti NLTK Stručná charakteristika NLTK je sada knihoven pro Python a programů pro symbolické a statistické zpracování

Více

České dráhy a.s. Generální ředitelství. Rozkaz. o doprovodu vlaků vlakovými četami. sešit 2. Krajské centrum Olomouc, Ostrava, Zlín

České dráhy a.s. Generální ředitelství. Rozkaz. o doprovodu vlaků vlakovými četami. sešit 2. Krajské centrum Olomouc, Ostrava, Zlín České dráhy a.s. Generální ředitelství Rozkaz o doprovodu vlaků vlakovými četami sešit 2 Krajské centrum Olomouc, Ostrava, Zlín Účinnost od 11. prosince 2005 Jen pro služební potřebu České dráhy Generální

Více

Usnesení 23. zasedání zastupitelstva městského obvodu konaného dne 26.06.2014. - 0589/ZMOb-Sle/1014/23

Usnesení 23. zasedání zastupitelstva městského obvodu konaného dne 26.06.2014. - 0589/ZMOb-Sle/1014/23 23. zasedání zastupitelstva městského obvodu konaného dne 26.06.2014 čís. 0569/ZMOb-Sle/1014/23-0589/ZMOb-Sle/1014/23 MUDr. Hana Heráková Místostarostka Ing. Petr Janíček Místostarosta Strana 1/14 Přehled

Více

Neřízené usměrňovače reálné vlastnosti

Neřízené usměrňovače reálné vlastnosti Počítačové cvičení BNEZ 1 Neřízené usměrňovače reálné vlastnosti Úkol 1: Úkol 2: Úkol 3: Úkol 4: Úkol 5: Pomocí programu OrCAD Capture zobrazte voltampérovou charakteristiku diody 1N4007 pro rozsah napětí

Více

Big Data. Josef Šlerka, Ataxo Interactive, SNM FF UK Business & Information Forum 2011, Praha

Big Data. Josef Šlerka, Ataxo Interactive, SNM FF UK Business & Information Forum 2011, Praha Big Data Josef Šlerka, Ataxo Interactive, SNM FF UK Business & Information Forum 2011, Praha 3 000 000 000 počet hledání na Googlu denně 30 000 000 000 počet zpráv a příspěvků na Facebooku měsíčně 5 000

Více

14/10/2015 Z Á K L A D N Í C E N Í K Z B O Ž Í Strana: 1

14/10/2015 Z Á K L A D N Í C E N Í K Z B O Ž Í Strana: 1 14/10/2015 Z Á K L A D N Í C E N Í K Z B O Ž Í Strana: 1 S Á ČK Y NA PS Í E XK RE ME N TY SÁ ČK Y e xk re m en t. p o ti sk P ES C Sá čk y P ES C č er né,/ p ot is k/ 12 m y, 20 x2 7 +3 c m 8.8 10 bl ok

Více

ANT. Aplikační programování v Javě (BI-APJ) - 1 Ing. Jiří Daněček Katedra softwarového inženýrství Fakulta informačních technologií ČVUT Praha

ANT. Aplikační programování v Javě (BI-APJ) - 1 Ing. Jiří Daněček Katedra softwarového inženýrství Fakulta informačních technologií ČVUT Praha ANT Aplikační programování v Javě (BI-APJ) - 1 Ing. Jiří Daněček Katedra softwarového inženýrství Fakulta informačních technologií ČVUT Praha Evropský sociální fond Praha & EU: Investujeme do vaší budoucnosti

Více

Vibrační. 112 Přehled VEGASWING 114 VEGASWING 51. 116 VEGASWING série 60. 124 Přehled VEGAVIB. 126 VEGAVIB série 60. 134 Přehled VEGAWAVE

Vibrační. 112 Přehled VEGASWING 114 VEGASWING 51. 116 VEGASWING série 60. 124 Přehled VEGAVIB. 126 VEGAVIB série 60. 134 Přehled VEGAWAVE Vibrační 112 Přehled VEGASWING 114 VEGASWING 51 116 VEGASWING série 60 124 Přehled VEGAVIB 126 VEGAVIB série 60 134 Přehled VEGAWAVE 136 VEGAWAVE série 60 111 Přehled VEGASWING Oblast použití Limitní spínače

Více

Lodish et al, Molecular Cell Biology, 4-6 vydání Alberts et al, Molecular Biology of the Cell, 4 vydání

Lodish et al, Molecular Cell Biology, 4-6 vydání Alberts et al, Molecular Biology of the Cell, 4 vydání Lodish et al, Molecular Cell Biology, 4-6 vydání Alberts et al, Molecular Biology of the Cell, 4 vydání http://web.natur.cuni.cz/~zdenap/zdenateachingnf.html CHEMICKÉ SLOŽENÍ BUŇKY BUŇKA: 99 % C, H, N,

Více

ZÁSADY PRO UZAVÍRÁNÍ SMLUV týkajících se inženýrských sítí, drobných a jiných staveb na pozemcích města Veselí nad Moravou

ZÁSADY PRO UZAVÍRÁNÍ SMLUV týkajících se inženýrských sítí, drobných a jiných staveb na pozemcích města Veselí nad Moravou č. j. MVNM/30173/2015 ZÁSADY PRO UZAVÍRÁNÍ SMLUV týkajících se inženýrských sítí, drobných a jiných staveb na pozemcích města Veselí nad Moravou I. ÚČEL Tyto Zásady pro uzavírání smluv týkajících se inženýrských

Více

Ant aneb Ferda Mravenec, práce všeho druhu

Ant aneb Ferda Mravenec, práce všeho druhu Ant aneb Ferda Mravenec, práce všeho druhu Nástroj na sestavování projektů (aplikací) podobný programu make, který se používá u programů v C či C++. Program Ant je volně k dispozici (tzv. The Apache Software

Více

Fragment based drug design

Fragment based drug design Fragment based drug design O E115 H114 K91 S161 R93 Q173 D171 OH NH 2 NH 2 O Cdk6 FGFR HGF N BRCA2 Proteiny buňkových regulačních systémů, ve kterých léčiva zasahují do interakcí protein-protein Fragmenty

Více

Usnesení 12. schůze rady městského obvodu konané dne 15.04.2015

Usnesení 12. schůze rady městského obvodu konané dne 15.04.2015 12. schůze rady městského obvodu konané dne 15.04.2015 čís. 0295/RMOb-Vit/1418/12-0320/RMOb-Vit/1418/12 Petr Dlabal starosta Mgr. Petr Kutěj místostarosta Strana 1 Přehled usnesení rady městského obvodu

Více

Usnesení 84. schůze rady městského obvodu konané dne 05.06.2013

Usnesení 84. schůze rady městského obvodu konané dne 05.06.2013 84. schůze rady městského obvodu konané dne 05.06.2013 čís. 2413/RMOb-Vit/1014/84-2424/RMOb-Vit/1014/84 Petr Dlabal starosta Ing. Leoš Adamík místostarosta Strana 1 Přehled usnesení rady městského obvodu

Více

První krůčky se SAS Enterprise Miner 6.2. Zaškrtněte Personal Workstation a přihlašte se jako localhost\sasdemo.

První krůčky se SAS Enterprise Miner 6.2. Zaškrtněte Personal Workstation a přihlašte se jako localhost\sasdemo. Zaškrtněte Personal Workstation a přihlašte se jako localhost\sasdemo. New Project Pojmenujte projekt a vyberte fyzickou cestu adresář na disku (s právem zápisu pro uživatele sasdemo), kde budou uložena

Více

Pokročilé Webové služby a Caché security. Š. Havlíček

Pokročilé Webové služby a Caché security. Š. Havlíček Pokročilé Webové služby a Caché security Š. Havlíček Webové služby co se tím míní? Webová služba metoda komunikace mezi dvěma elektronickými zařízeními přes internet Typicky jsou pomocí rozhraní přístupné

Více

Válec pístní tyče Normované válce ISO 15552, série TRB. Katalogová brožurka

Válec pístní tyče Normované válce ISO 15552, série TRB. Katalogová brožurka ISO 15552, série TRB Katalogová brožurka 2 ISO 15552, série TRB Válec zakotvení Přípoje: G 1/8 - G 1/2 Dvojčinný S magnetickým pístem Tlumení: pneumaticky, nastavitelný Pístní tyč: Vnější závit Volitelně

Více

Má tajemný clusterin u dětí v septickém stavu aktivitu chaperonu? J. Žurek, P.Košut, M. Fedora

Má tajemný clusterin u dětí v septickém stavu aktivitu chaperonu? J. Žurek, P.Košut, M. Fedora Má tajemný clusterin u dětí v septickém stavu aktivitu chaperonu? J. Žurek, P.Košut, M. Fedora Klinika dětské anesteziologie a resuscitace, Lékařská fakulta MU, Fakultní nemocnice Brno DNA transkripce

Více

Dána geometrickým uspořádáním polypeptidového řetězce

Dána geometrickým uspořádáním polypeptidového řetězce Otázka: Bílkoviny Předmět: Chemie Přidal(a): denisa Základní stavební jednotka živé hmoty, přítomné ve všech buňkách. Složení: z 20 základních aminokyselin Funkce: Stavební- kolagen-chrupavky, elastin-el.vazivo,

Více

Obecné principy chemických strukturních bází dat předmět projektu VaVpI ChemEIZ

Obecné principy chemických strukturních bází dat předmět projektu VaVpI ChemEIZ Obecné principy chemických strukturních bází dat předmět projektu VaVpI ChemEIZ Jaroslav Šilhánek Strukturní báze dat = Grafická representace struktur chemických sloučenin (+ další informace) Reakční

Více

ž ě č Č š ě ě ž Ě š š ě Š ě ě ě ž ů ě Ě ě Š č ě č č ž č č Č Ě š Ě š ě ě š ě ě ě ž Ů ě č ě Š Š č ž Ý Óž Ó č ÝŠ č š ú ě š č č č šť Š šť šť Ú ú ů Š Ú ů ú Š ž ě ě ě ů ě ě ě ů ě ě ž ů ě ů ž ž ě č ě č ě č ů

Více

Sínusový měnič napětí s funkcí UPS WT 1000-3000

Sínusový měnič napětí s funkcí UPS WT 1000-3000 Sínusový měnič napětí s funkcí UPS WT 1000-3000 Pozor: Vysoké napětí- nikdy neotvírejte přístroj 1- připojte měnič ke správnému DC napětí 12-24-48V, připojovací kabely musí být co nejkratší příliš dlouhé

Více

Možnosti využití technologie DNA microarrays v predikci odpovědi na neoadjuvantní terapii u pacientů s karcinomem jícnu

Možnosti využití technologie DNA microarrays v predikci odpovědi na neoadjuvantní terapii u pacientů s karcinomem jícnu Možnosti využití technologie DNA microarrays v predikci odpovědi na neoadjuvantní terapii u pacientů s karcinomem jícnu Srovnal J. 1, Cincibuch J. 2, Cwierkta K. 2, Melichar B. 2, Aujeský R. 3, Vrba R.

Více

Vazebné interakce protein s DNA

Vazebné interakce protein s DNA Vazebné interakce protein s DNA Vazebné možnosti vn jší vazba atmosféra + iont kolem nabité DNA vazba ve žlábku van der Waalsovský kontakt s lé ivem ve žlábku interkalace vmeze ení planárního aromat.

Více

WinFast TV2000 XP HARDWARE GUIDE. Obsah

WinFast TV2000 XP HARDWARE GUIDE. Obsah WinFast TV2000 XP HARDWARE GUIDE Obsah Součásti balení Specifikace Systémové požadavky Odebrání starších ovladačů a aplikací Hardwarová instalace Připojení vstup/výstup zařízení Instalace aplikace a ovladačů

Více

. UNEP Ochrana půd CH 4 N 2 O http://chm.pops.int/home/tabid/2121/mctl/viewdetails/eventmodid/871/ev entid/407/xmid/6921/default.aspx http://www.enviroliteracy.org/subcategory.php/36.html www.amo.cz

Více

BDVR 2.5. Návod na použití

BDVR 2.5. Návod na použití Vážený zákazníku! Děkujeme Vám, za zakoupení přenosného záznamového zařízení DVR. Před použitím si pozorně přečtěte tento návod na použití. Popis Zařízení 2 1) SD slot 2) Zelená LED (spuštěné zařízení)

Více

Usnesení 98. schůze rady městského obvodu konané dne 18.12.2013

Usnesení 98. schůze rady městského obvodu konané dne 18.12.2013 98. schůze rady městského obvodu konané dne 18.12.2013 čís. 2889/RMOb-Vit/1014/98-2932/RMOb-Vit/1014/98 Petr Dlabal starosta MUDr. Jindřich Prokop místostarosta Strana 1 Přehled usnesení rady městského

Více

Přehled a definice seznamů

Přehled a definice seznamů Přehled a definice seznamů Verze 2009 05 05 L{P1} Project Repositories Listing Popis: Přehled všech vytvořených Repository komponent v daném Projectu; Skupina: Project Components; Titulek: Components:

Více

Revit link. Propojení mezi Scia Engineer a Revit structure

Revit link. Propojení mezi Scia Engineer a Revit structure Propojení mezi Scia Engineer a Revit structure Tento dokument je určen pouze uživatelům produktů firmy SCIA s platnou licencí pro informační účely a je poskytován "tak jak je", to je bez jakýchkoliv záruk,

Více

Usnesení. Usnesení 60. schůze rady městského obvodu konané dne 30.05.2013. 3360/RMOb-Sle/1014/60-3429/RMOb-Sle/1014/60

Usnesení. Usnesení 60. schůze rady městského obvodu konané dne 30.05.2013. 3360/RMOb-Sle/1014/60-3429/RMOb-Sle/1014/60 60. schůze rady městského obvodu konané dne 30.05.2013 čís. 3360/RMOb-Sle/1014/60-3429/RMOb-Sle/1014/60 Ing. Antonín Maštalíř starosta MUDr. Hana Heráková místostarostka Strana 1/50 Přehled usnesení rady

Více

Digitální učební materiál

Digitální učební materiál Digitální učební materiál Projekt Šablona Tématická oblast DUM č. CZ.1.07/1.5.00/34.0415 Inovujeme, inovujeme III/2 Inovace a zkvalitnění výuky prostřednictvím ICT (DUM) Anglický jazyk pro obor podnikání

Více

ř ý š ř ů Ť ň ř š ú ú ř š ř ř ř š š ř ů ů ř š ý ý ř š ů ů ů ý Žš ý Ž ý ý ý ý š ů ů šř ř ýš ř ž ý ý šť ž ž ý šť ř š š ř š ř ý ů Ž ýš ú š ů š ž ý ý ž ž š ý š ý ř š ý ů ý ř š ů š ó ř ýš ž ý ý š ř ů ž ý ý

Více

Návod na použití Dveřní jednotka DJ 1T, DJ 2T Stránka 1

Návod na použití Dveřní jednotka DJ 1T, DJ 2T Stránka 1 DJ 1T v2, DJ2T v2 Návod na použití Návod na použití Dveřní jednotka DJ 1T, DJ 2T Stránka 1 Mechanické části a jejich funkce Připojení kabelů Hlavní port pro připojení DJ: BUS: Připojení k nepolarizované

Více

Communist Party of Nepal (Unified Marxist-Leninist) Unified Modeling Language University of Massachusetts Lowell User-mode Linux.

Communist Party of Nepal (Unified Marxist-Leninist) Unified Modeling Language University of Massachusetts Lowell User-mode Linux. Jan Smolík UML UML Communist Party of Nepal (Unified Marxist-Leninist) Unified Modeling Language University of Massachusetts Lowell User-mode Linux Zdroj: Wikipedia Unified modelling language Neproprietární

Více

Studijní materiály pro bioinformatickou část ViBuChu. úloha II. Jan Komárek, Gabriel Demo

Studijní materiály pro bioinformatickou část ViBuChu. úloha II. Jan Komárek, Gabriel Demo Studijní materiály pro bioinformatickou část ViBuChu úloha II Jan Komárek, Gabriel Demo Adenin Struktura DNA Thymin 5 konec 3 konec DNA tvořena dvěmi řetězci orientovanými antiparalelně (liší se orientací

Více

AirKIT TECHNICKÝ MANUÁL. TnG-AirKIT. Power. Run

AirKIT TECHNICKÝ MANUÁL. TnG-AirKIT. Power. Run TnG-Air AirKIT + TnG-AirKIT - ok Power Run TECHNICKÝ MANUÁL 2. 1. ELEKTRICKÉ POPIS OVLÁDACÍCH ZAPOJENÍ PRVKŮ 1.1. AirKIT mod.2012 ovládací prvky 1 5 4 3 + TnG-AirKIT - Power ok Run 7 6 AirKIT ovládací

Více

Souhrn výsledků 7. zasedání zastupitelstva města konaného dne 23. 06. 2015

Souhrn výsledků 7. zasedání zastupitelstva města konaného dne 23. 06. 2015 M ě s t o Š e n o v okres Ostrava - město Souhrn výsledků 7. zasedání zastupitelstva města konaného dne 23. 06. 2015 Zastupitelstvo města: a) bere na vědomí: 1. Kontrolu usnesení z minulých zasedání splněny

Více

Výukový materiál zpracován v rámci projektu EU peníze školám Registrační číslo projektu: CZ.1.07/1.5.00/34.0996

Výukový materiál zpracován v rámci projektu EU peníze školám Registrační číslo projektu: CZ.1.07/1.5.00/34.0996 Výukový materiál zpracován v rámci projektu EU peníze školám Registrační číslo projektu: CZ.1.07/1.5.00/34.0996 Šablona: III/2 č. materiálu: VY_32_INOVACE_CHE_413 Jméno autora: Mgr. Alena Krejčíková Třída/ročník:

Více

Django, 2. cvičení url, views, templates. Úvod

Django, 2. cvičení url, views, templates. Úvod Django, 2. cvičení url, views, templates. Úvod Views v djangu jsou funkce (definovány ve views.py souboru aplikace, na které jsou mapovány URL adresy. Jejich úkolem je vrátit odpověď na HTTP požadavek.

Více

PLANAR - měřící servisní technika a monitoring zpětných směrů

PLANAR - měřící servisní technika a monitoring zpětných směrů PLANAR Multifunkční měřící přístroj a monitoring zpětných směrů Jiří Göllner, PROFiber Networking CZ s.r.o. info@profiber.eu www.profiber.eu PLANAR - měřící servisní technika a monitoring zpětných směrů

Více

Popis programu: Popis přípon důležitých souborů: *.qpf projektový soubor Quartusu

Popis programu: Popis přípon důležitých souborů: *.qpf projektový soubor Quartusu Software Quartus II Popis programu: Quartus II Web Edition je označení bezplatného software, s jehož pomocí lze napsat, zkompilovat, odsimulovat a naprogramovat FPGA a CPLD obvody firmy Altera. Cílem tohoto

Více

Řídící jednotka Wingokit A 400. Řídící jednotka A 400

Řídící jednotka Wingokit A 400. Řídící jednotka A 400 Řídící jednotka Wingokit A 400 Řídící jednotka A 400 1 Řídící jednotka Wingokit A 400 A 400 Obsah: str. str. 1... Popis výrobku 3 2... Instalace 3 2.1 Kontrola před montáží 3 2.2 Montáž řídící jednotky

Více

CertReview Uživatelská příručka

CertReview Uživatelská příručka CertReview Uživatelská příručka Služba CertReview slouží k on-line ověření elektronických podpisů a kvalifikovaných certifikátů. Je založena na vyhodnocení platnosti proti seznamům zneplatněných certifikátů

Více

Metodika 3: uvedení systému Jasco LC 2000 do provozu

Metodika 3: uvedení systému Jasco LC 2000 do provozu Metodika 3: uvedení systému Jasco LC 2000 do provozu (HPLC High Performance Liquid Chromatography) 7 8 4 9 10 1 2 5 11 3 6 12 Popis sestavy: 1) Refraktometrický detektor RI 2000, 2) detektor diodového

Více

Š Ě É ě ě ů ď č ě ě Č Á č ě ě ě é ě é ř ů č ě ý ř ů ě é ř é é ř ú č é ý é ů é č ř ě Ť ů ý ý ů č ě ď é ě ý é é é ř ď ý ř ť ř é ě ň ť č ďě č ě ý é č ě ř ň ů ě ř ě ě ě é ů é é č ě ů é č ě é ě ď č ý ě ů ů

Více

Předmět: Konstrukční cvičení - modelování součástí ve 3D. Téma 11: Tvorba výkresů 1

Předmět: Konstrukční cvičení - modelování součástí ve 3D. Téma 11: Tvorba výkresů 1 Předmět: Konstrukční cvičení - modelování součástí ve 3D Téma 11: Tvorba výkresů 1 Učební cíle Porozumění podstaty práce ve výkresovém modulu. Porozumění různým typům výkresových pohledů. Tvorba, úprava,

Více

egon v České republice

egon v České republice egon v České republice verze 2012 Aleš Kučera Novell-Praha akucera@novell.cz egon v ČR, verze 2012 Build 2007.03.38 Czech POINT Build 2009.07.01 Informační systém datových schránek Build 2011.11.29 Novela

Více

Direct emailing na míru Emailing podle kategorií Traffic pro váš web Databáze firem SMS kampaně Propagace přes slevový portál Facebook marketing

Direct emailing na míru Emailing podle kategorií Traffic pro váš web Databáze firem SMS kampaně Propagace přes slevový portál Facebook marketing I N T E R N E T O V Ý M A R K E T I N G e f e k t i v n í a c í l e n ý m a r k e t i n g p r o f e s i o n á l n í e m a i l i n g š p i č k o v é t e c h n i c k é z á z e m í p r o p r a c o v a n é

Více

Usnesení z 10. schůze Rady města Bechyně konané dne 8. 4. 2015 (usnesení č. 114-131)

Usnesení z 10. schůze Rady města Bechyně konané dne 8. 4. 2015 (usnesení č. 114-131) Usnesení z 10. schůze Rady města Bechyně konané dne 8. 4. 2015 (usnesení č. 114-131) USNESENÍ č. 114/10-15 R 1. přidělit byt č. 120 o vel. 1+0 v prvním podlaží Domu s pečovatelskou službou v Bechyni, Školní

Více

Špionážní tužka s HD kamerou Manual. (typ - propiska)

Špionážní tužka s HD kamerou Manual. (typ - propiska) Špionážní tužka s HD kamerou Manual (typ - propiska) Přečtěte si laskavě tento Návod k použití před prvním použitím přístroje. Obsah návodu PŘEČTĚTE SI LASKAVĚ TENTO NÁVOD K POUŽITÍ PŘED PRVNÍM POUŽITÍM

Více

Uvádění pixelového detektoru experimentu ATLAS do provozu

Uvádění pixelového detektoru experimentu ATLAS do provozu Seminář ATLAS FZU AV ČR 28/3/2008 Uvádění pixelového detektoru experimentu ATLAS do provozu Pavel Jež FZU AVČR, v.v.i. FJFI ČVUT Pixelový detektor status Hlavní rozcestník: https://twiki.cern.ch/twiki/bin/

Více

Mitochondriální genom, úloha mitochondrií v buněčném metabolismu, signalizaci a apoptóze

Mitochondriální genom, úloha mitochondrií v buněčném metabolismu, signalizaci a apoptóze Mitochondriální genom, úloha mitochondrií v buněčném metabolismu, signalizaci a apoptóze MUDr. Jan Pláteník, PhD březen 2007 Mitochondrie:... původně fagocytované/parazitující bakterie čtyři kompartmenty:

Více

Změna vlastností kódem

Změna vlastností kódem Změna vlastností kódem - Metoda setjménovlastnosti(hodnota); - Zadání úkolu Změna vlastností kódem Práce s vlastnostmi Metody setxxx nastavení vlastnosti Metody getxxx zjištění hodnoty vlastnosti případně

Více

její základní velikost je třetina stupně písma (třetina čtverčíku) čtverčík čtverec o straně velikosti kuželky mezera na čtverčík ⅓čtverčíku

její základní velikost je třetina stupně písma (třetina čtverčíku) čtverčík čtverec o straně velikosti kuželky mezera na čtverčík ⅓čtverčíku 1. Učíme se správně psát skládáme slova zarovnání psaní znamének dělení slov hladká sazba Skládáme slova mezislovní mezera vzdálenost mezi slovy; její základní velikost je třetina stupně písma (třetina

Více

Primárně spínané napájecí zdroje

Primárně spínané napájecí zdroje Primárně spínané napájecí zdroje Řada CP Obsah Řada CP... 196 Výběrová tabulka... 197 Schválení a značky... 198 Řada CP-D... 199 Výhody... 200 Podrobnosti pro objednávku... 201... 202 Technické diagramy...

Více

INTERSTENO 2013Ghent Mistrovstvísvta v profesionálním word processingu

INTERSTENO 2013Ghent Mistrovstvísvta v profesionálním word processingu POUŽITÝ OPERAČNÍ SYSTÉM POUŽITÝ SOFTWARE PRO WORD PROCESSING SOUTĚŽNÍ ID A 1 Instrukce pro účastníky Otevřete dokument TRANSPORT.DOC, ihned uložte jako TRANSPORTXXX.DOCneboDOCX,kde XXX je Vašesoutěžní

Více

Programovací software Oblast režimů Oblast nástrojů Složka aplikací pro různé funkce: Oblast tlačítek Tlačítko Loading (Načítání)

Programovací software Oblast režimů Oblast nástrojů Složka aplikací pro různé funkce: Oblast tlačítek Tlačítko Loading (Načítání) Programovací software 1. Struktura funkcí myši ErgoMedia 500 Hlavní obrazovka struktury funkcí Zobrazuje programované klávesy. Hlavní obrazovka myši ErgoMedia 500: Oblast režimů K dispozici jsou čtyři

Více