Strukturní biologie. Vojtěch Spiwok.

Rozměr: px
Začít zobrazení ze stránky:

Download "Strukturní biologie. Vojtěch Spiwok."


1 Strukturní biologie Vojtěch Spiwok

2 Domácí úkol: Instrukce: Vytvořte obrázek prostorové struktury vylosovaného proteinu tak, aby z něj byla dobře patrná interakce proteinové části s ligandem nebo ligandy (kofaktory, inhibitory atd). Obrázek musí mít bílé pozadí. Pro proteinovou část použijte reprezentaci bez zobrazení jednotlivých atomů (např. ribon, cartoon a podobně). Pro neproteinovou část použijte zobrazení jednotlivých atomů (sticks, ball&sticks, spheres atd, ale ne lines). Pokud je to vhodné, je možné stejným způsobem zobrazit i atomy vybraných aminokyselinových zbytků. V případě vícepodjednotkových proteinů je možné zobrazit pouze jednu podjednotku, zvláště pokud se nejedná o biologický oligomer (např. je jejich interakce důsledkem krystalizace). V obrázku je možné popsat jednotlivé podjednotky, ligandy, rezidua a podobně. Pro tyto popisky použijte písmo Helvetica. Celý obrázek musí být ve formátu tiff, na šířku musí mít 6-8 cm a rozlišení 300 dpi. K obrázku připojte krátký popisek. V něm uveďte jaký software byl použit. Vhodný software: PyMol - VMD - UCSF Chimera - nebo jiný

3 Domácí úkol: 1e4v 1ffy 1gal 1ipw 1k22 1n2c 1u70 1upp 1v97 1w4w 1yq2 2fbw 2jhf 2r4f 2vk4 2x91 2xfu 3b7e 3div 3f0t 3g2h 3gzk 3ha1 3hw7 3i9v 3ihj 3jwq 3k4v 3lii 3lxe 3m8r 3maa 3n10 3n8v 3txt 4ake 4ea3 4k5y 4l0d 4l6r 4n6h 4oo9 4or2 8tim

4 Prostorové struktury proteinů



7 Prostorové struktury proteinů 4iy0 Pymol VMD USCF Chimera

8 Předpověď prostorových struktur proteinů 1. Homologní modelování Proteiny s podobnou sekvencí mají (obvykle) podobnou prostorovou strukturu. 2. Identifikace způsobu sbalení Proteiny mohou mít podobnou prostorovou strukturu a nemusí mít (na první pohled) podobnou sekvenci. 3. Ab initio, de novo Nativní struktura proteinu má vlastnosti, které jí odlišují od ostatních struktur. 4. Simulace sbalování proteinu Nativní struktura je minimem volné energie proteinu.

9 Homologní modelování Proteiny s podobnou sekvencí mají (obvykle) podobnou prostorovou strukturu. Abl kinasa 1opl p38 kinasa 1w84 insulinový receptor 1irk


11 Homologní modelování Proteiny s podobnou sekvencí mají (obvykle) podobnou prostorovou strukturu. Swiss Model Modeller Postup: 1. nalezení sekvenčně podobného proteinu (proteinů) se známou prostorovou strukturou (např. BLAST) 2. zarovnání sekvencí (Clustal, NW) 3. vytvoření modelu (modeller) 4. kontrola modelu (Prosa, Verify3D)

12 Modeller Potřebujeme: 1. zarovnání sekvencí 2. struktury templátů 3. instrukce Zarovnání sekvencí Jméno souboru templátu číslo prvního residua číslo posledního residua C; A sample alignment in the PIR format; used in tutorial >P1;5fd1 structurex:5fd1:1 :A:106 :A:ferredoxin:Azotobacter vinelandii: 1.90: 0.19 AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELA EVWPNITEKKDPLPDAEDWDGVKGKLQHLER* >P1;1fdx sequence:1fdx:1 : :54 : :ferredoxin:peptococcus aerogenes: 2.00: 1.00 AYVINDSC IACGACKPECPVNIIQGS IYAIDADSCIDCGSCASVCPVGAPNPED * řetězec posledního residua Jméno modelu řetězec prvního residua

13 Modeller Potřebujeme: 1. zarovnání sekvencí 2. struktury templátů 3. instrukce umístění templátu(ů) Instrukce # Homology modeling by the automodel class from modeller import * # Load standard Modeller classes from modeller.automodel import * # Load the automodel class log.verbose() # request verbose output env = environ() # create a new MODELLER environment to build this model in # directories for input atom files = ['.', '../atom_files'] název souboru zarovnání a = automodel(env, alnfile = 'alignment.ali', # alignment filename knowns = '5fd1', # codes of the templates sequence = '1fdx') # code of the target a.starting_model= 1 # index of the first model a.ending_model = 1 # index of the last model # (determines how many models to calculate) a.make() # do the actual homology modeling index posledního modelu název templátu(ů) název modelu

14 Modeller Potřebujeme: 1. zarovnání sekvencí 2. struktury templátů 3. instrukce Vlastní spuštění: python model Vlastní spuštění: mod9.14 model


16 Modeller Co dál? Více řetězců C; A sample alignment in the PIR format; used in tutorial >P1;1XXX structurex:1xxx:1 :A:666 :C:::: XXXXXXXXX... XXXXXXXXXXXXX/ XXX XX... XXX* >P1;model sequence:model:1 :C:::: XXXXXXXXX... XXXX XXXXX/ XXXXXXXXX... XXX*

17 Modeller Co dál allhmodel přidá vodíky # Homology modeling by the automodel class from modeller import * # Load standard Modeller classes from modeller.automodel import * # Load the automodel class log.verbose() # request verbose output env = environ() # create a new MODELLER environment to build this model in # directories for input atom files = ['.', '../atom_files'] ('5fd1', '1xxx'), více templátů a = automodel(env, alnfile = 'alignment.ali', # alignment filename knowns = '5fd1', # codes of the templates sequence = '1fdx') # code of the target a.starting_model= 1 # index of the first model a.ending_model = 1 # index of the last model # (determines how many models to calculate) a.make() # do the actual homology modeling modelů

18 Modeller Co dál? Disulfidové můstky # Homology modeling by the automodel class from modeller import * # Load standard Modeller classes from modeller.automodel import * # Load the automodel class # Redefine the special_patches routine to include the additional disulfides # (this routine is empty by default): class MyModel(automodel): def special_patches(self, aln): # A disulfide between residues 8 and 45: self.patch(residue_type='disu', residues=(self.residues['8'], self.residues['45'])) log.verbose() # request verbose output env = environ() # create a new MODELLER environment to build this model in # directories for input atom files = ['.', '../atom_files'] a = MyModel(env, alnfile = 'alignment.ali', # alignment filename knowns = '5fd1', # codes of the templates sequence = '1fdx') # code of the target a.starting_model= 1 # index of the first model a.ending_model = 1 # index of the last model # (determines how many models to calculate) a.make() # do the actual homology modeling

19 Modeller Co dál? Vnucení sekundární struktury # Homology modeling by the automodel class from modeller import * # Load standard Modeller classes from modeller.automodel import * # Load the automodel class class MyModel(automodel): def special_restraints(self, aln): rsr = self.restraints at = self.atoms rsr.add(secondary_structure.alpha(self.residue_range('20:', '30:'))) log.verbose() # request verbose output env = environ() # create a new MODELLER environment to build this model in # directories for input atom files = ['.', '../atom_files'] a = MyModel(env, alnfile = 'alignment.ali', # alignment filename knowns = '5fd1', # codes of the templates sequence = '1fdx') # code of the target a.starting_model= 1 # index of the first model a.ending_model = 1 # index of the last model # (determines how many models to calculate) a.make() # do the actual homology modeling


21 Identifikace způsobu sbalení Proteiny mohou mít podobnou prostorovou strukturu a nemusí mít (na první pohled) podobnou sekvenci. PHYRE2 Fold Recognition - UCLA-DOE I-TASSER

22 Ab initio, de novo Nativní struktura proteinu má vlastnosti, které jí odlišují od ostatních struktur. FoldIT

23 Simulace sbalování proteinu Nativní struktura je minimem volné energie proteinu. K. Lindorff-Larsen, S. Piana, R.O. Dror, D.E.Shaw: How Fast-Folding Proteins Fold. Science 2011, 334(6055)

24 Simulace sbalování proteinu Nativní struktura je minimem volné energie proteinu. VIDEO

25 CASP Critical Assessment of protein Structure Prediction

26 CASP Critical Assessment of protein Structure Prediction

Enzymové pexeso. L: lactose P: operon

Enzymové pexeso.  L: lactose P: operon Enzymové pexeso L: lactose P: operon Struktura proteinů: Primární: Struktura proteinů: Primární: Sekvenování: - sekvenováním (c)dna - hmotnostní spektrometrií


Bioinformatika a výpočetní biologie KFC/BIN. I. Přehled

Bioinformatika a výpočetní biologie KFC/BIN. I. Přehled Bioinformatika a výpočetní biologie KFC/BIN I. Přehled RNDr. Karel Berka, Ph.D. Univerzita Palackého v Olomouci Definice bioinformatiky (Molecular) bio informatics: bioinformatics is conceptualising biology


Genomické databáze. Shlukování proteinových sekvencí. Ivana Rudolfová. školitel: doc. Ing. Jaroslav Zendulka, CSc.

Genomické databáze. Shlukování proteinových sekvencí. Ivana Rudolfová. školitel: doc. Ing. Jaroslav Zendulka, CSc. Genomické databáze Shlukování proteinových sekvencí Ivana Rudolfová školitel: doc. Ing. Jaroslav Zendulka, CSc. Obsah Proteiny Zdroje dat Predikce struktury proteinů Cíle disertační práce Vstupní data


Služby pro predikci struktury proteinů. Josef Pihera

Služby pro predikci struktury proteinů. Josef Pihera Služby pro predikci struktury proteinů Josef Pihera Struktura proteinů Primární sekvence aminokyselin Sekundární stáčení a spojování vodíkovými vazbami Supersekundární struktura přechod, opakovaná geometrická


Hemoglobin a jemu podobní... Studijní materiál. Jan Komárek

Hemoglobin a jemu podobní... Studijní materiál. Jan Komárek Hemoglobin a jemu podobní... Studijní materiál Jan Komárek Bioinformatika Bioinformatika je vědní disciplína, která se zabývá metodami pro shromážďování, analýzu a vizualizaci rozsáhlých souborů biologických


MĚSTSKÁ ČÁST PRAHA 3 Zastupitelstvo městské části U S N E S E N Í

MĚSTSKÁ ČÁST PRAHA 3 Zastupitelstvo městské části U S N E S E N Í č.j.: 688/2016 MĚSTSKÁ ČÁST PRAHA 3 Zastupitelstvo městské části U S N E S E N Í č. 232 ze dne 20.09.2016 Prodej nemovité věci dle zák. č. 89/2012 Sb., občanský zákoník, v platném znění - pronajatých bytových


PDB File Format. PDB Format Guide

PDB File Format. PDB Format Guide PDB File Format PDB Format Guide 1 PDB File Format PDB File Format 2 PyMOL.. open-source, user-sponsored, molecular visualization system created by Warren Lyford DeLano and commercialized by DeLano Scientific


Aplikovaná bioinformatika

Aplikovaná bioinformatika Aplikovaná bioinformatika Číslo aktivity: 2.V Název klíčové aktivity: Na realizaci se podílí: Implementace nových předmětů do daného studijního programu doc. RNDr. Michaela Wimmerová, Ph.D., Mgr. Josef


Usnesení 16. zasedání zastupitelstva městského obvodu konaného dne 11.03.2013

Usnesení 16. zasedání zastupitelstva městského obvodu konaného dne 11.03.2013 16. zasedání zastupitelstva městského obvodu konaného dne 11.03.2013 čís. 0313/ZMOb-Vit/1014/16-0340/ZMOb-Vit/1014/16 Petr Dlabal starosta Ing. Leoš Adamík místostarosta Strana 1 Přehled usnesení zastupitelstva


Bioinformatika pro PrfUK 2003

Bioinformatika pro PrfUK 2003 Bioinformatika pro PrfUK 2003 Jiří Vondrášek Ústav organické chemie a biochemie Jan Pačes Ústav molekulární genetiky What is Bioinformatics?---The


Usnesení 90. mimořádné schůze rady městského obvodu konané dne 27.08.2014. - 4749/RMObM-Sle/1014/90

Usnesení 90. mimořádné schůze rady městského obvodu konané dne 27.08.2014. - 4749/RMObM-Sle/1014/90 90. mimořádné schůze rady městského obvodu konané dne 27.08.2014 čís. 4743/RMObM-Sle/1014/90-4749/RMObM-Sle/1014/90 MUDr. Hana Heráková Místostarostka Radomír Mandok Uvolněný člen rady Strana 1/14 Přehled


OBSAH. strana. Hroty 1, 2. Céčka a eska. strana 2, 3. strana. Šišky. Gule a polgule. strana 5, strana

OBSAH. strana. Hroty 1, 2. Céčka a eska. strana 2, 3. strana. Šišky. Gule a polgule. strana 5, strana OBSAH Hroty 1, 2 Céčka a eska 2, 3 Šišky 3 Gule a polgule 4 Hrozno 5, 6 Lístky 7... 10 Tyčky a stĺpiky 11... 13 Pásoviny a madlá 14, 15 Pätky a krytky 16 Závesy 17 Kľučky 18, 19 Štítky Sortiment pojazdných


MĚSTSKÁ ČÁST PRAHA 3 Rada městské části U S N E S E N Í

MĚSTSKÁ ČÁST PRAHA 3 Rada městské části U S N E S E N Í č.j.: 176/2015 MĚSTSKÁ ČÁST PRAHA 3 Rada městské části U S N E S E N Í č. 151 ze dne 09.03.2015 Prodej nemovité věci dle zák.č. 89/2012 Sb., Občanský zákoník, v platném znění pronajatých bytových jednotek


Usnesení 86. schůze rady městského obvodu konané dne 03.07.2013

Usnesení 86. schůze rady městského obvodu konané dne 03.07.2013 86. schůze rady městského obvodu konané dne 03.07.2013 čís. 2470/RMOb-Vit/1014/86-2498/RMOb-Vit/1014/86 Petr Dlabal starosta MUDr. Jindřich Prokop místostarosta Strana 1 Přehled usnesení rady městského


- 0331/RMOb-Mich/1418/22

- 0331/RMOb-Mich/1418/22 22. schůze rady městského obvodu konané dne 05.10.2015 čís. 0312/RMOb-Mich/1418/22-0331/RMOb-Mich/1418/22 Ing. Martin Juroška, Ph.D. starosta Ing. Vladimír Kozel místostarosta Strana 1/11 Přehled usnesení


Úvod do datového a procesního modelování pomocí CASE Erwin a BPwin

Úvod do datového a procesního modelování pomocí CASE Erwin a BPwin Úvod do datového a procesního modelování pomocí CASE Erwin a BPwin (nově AllFusion Data Modeller a Process Modeller ) Doc. Ing. B. Miniberger,CSc. BIVŠ Praha 2009 Tvorba datového modelu Identifikace entit


MĚSTSKÁ ČÁST PRAHA 3 Zastupitelstvo městské části U S N E S E N Í. č. 490 ze dne 17.06.2014

MĚSTSKÁ ČÁST PRAHA 3 Zastupitelstvo městské části U S N E S E N Í. č. 490 ze dne 17.06.2014 č.j.: 424/2014 MĚSTSKÁ ČÁST PRAHA 3 Zastupitelstvo městské části U S N E S E N Í č. 490 ze dne 17.06.2014 Prodej nemovité věci dle zák. č. 89/2012 Sb., Občanský zákoník, v platném znění - pronajatých bytových


MĚSTSKÁ ČÁST PRAHA 3 Rada městské části U S N E S E N Í

MĚSTSKÁ ČÁST PRAHA 3 Rada městské části U S N E S E N Í č.j.: 153/2015 MĚSTSKÁ ČÁST PRAHA 3 Rada městské části U S N E S E N Í č. 112 ze dne 02.03.2015 Prodej nemovité věci dle zák.č. 89/2012 Sb., Občanský zákoník, v platném znění pronajatých bytových jednotek





Využití strojového učení k identifikaci protein-ligand aktivních míst

Využití strojového učení k identifikaci protein-ligand aktivních míst Využití strojového učení k identifikaci protein-ligand aktivních míst David Hoksza, Radoslav Krivák SIRET Research Group Katedra softwarového inženýrství, Matematicko-fyzikální fakulta Karlova Univerzita


Řada C55. Pneumatické lineární pohony. Kompaktní válec podle normy ISO 21287

Řada C55. Pneumatické lineární pohony. Kompaktní válec podle normy ISO 21287 Pneumatické lineární pohony Kompaktní válec podle normy ISO 21287 rozměry podle normy ISO 21287 jednoduchá montáž snímačů polohy ze 4 stran, drážky v tělese válce pro upevnění snímačů polohy standardně


Usnesení z 19. schůze Rady města Bechyně konané dne (usnesení č )

Usnesení z 19. schůze Rady města Bechyně konané dne (usnesení č ) Usnesení z 19. schůze Rady města Bechyně konané dne 3. 10. 2012 (usnesení č. 312-325) USNESENÍ č. 312/19-12 R I. s o u h l a s í se změnou v osobě nájemce bytu č. 2 o velikosti 2+1 v prvním patře domu


Kyvné pohony Série 6400. Miniaturní kompaktní suporty Série 6700. Tlumiče nárazu Série 6900

Kyvné pohony Série 6400. Miniaturní kompaktní suporty Série 6700. Tlumiče nárazu Série 6900 Manipulace Série 000 SpA 4050 LURANO (BG) - Italia Via Cascina Barbellina, 0 Tel. 035/49777 Fax 035/49740 035/4974 CAP. SOC...700.000 I.V. R.E.A. BERGAMO N. 0798 R.E.A. MILANO



VÝZNAM FUNKCE PROTEINŮ V MEDICÍNĚ FUNKCE PROTEINŮ 1 VÝZNAM FUNKCE PROTEINŮ V MEDICÍNĚ Příklad: protein: dystrofin onemocnění: Duchenneova svalová dystrofie 2 3 4 FUNKCE PROTEINŮ: 1. Vztah struktury a funkce proteinů 2. Rodiny proteinů


Upozornění : barevné odstíny zobrazené na této stránce se mohou z důvodu možného zkreslení Vašeho monitoru lišit od fyzické dodávky.

Upozornění : barevné odstíny zobrazené na této stránce se mohou z důvodu možného zkreslení Vašeho monitoru lišit od fyzické dodávky. Upozornění : barevné odstíny zobrazené na této stránce se mohou z důvodu možného zkreslení Vašeho monitoru lišit od fyzické dodávky. ODSTÍN SKUPINA CENOVÁ SKUPINA ODRÁŽIVOST A10-A BRIGHT A 1 81 A10-B BRIGHT


NÁVOD K OBSLUZE LAN ovladač s relé

NÁVOD K OBSLUZE LAN ovladač s relé NÁVOD K OBSLUZE LAN ovladač s relé 1. Vlastnosti Správa přes WWW nebo SNMP v2. Firmware upgrade přes TFTP Zobrazovaná data v reálném čase bez nutnosti obnovení WWW stránky Ovládání až 5 relé přímo z webového


Stručné shrnutí v bodech

Stručné shrnutí v bodech ISDS Instrukce pro vývojáře aplikací třetích stran Nové SSL certifikáty s SHA-256 Aktualizovaná a doplněná verze ze dne 4.8.2015, která nahrazuje verzi 1.1 ze dne 28.7.2015 Předkládá O2 Czech Republic


Semestrální práce z předmětu. Jan Bařtipán / A03043

Semestrální práce z předmětu. Jan Bařtipán / A03043 Semestrální práce z předmětu KIV/UPA Jan Bařtipán / A03043 Zadání Program přečte ze vstupu dvě čísla v hexadecimálním tvaru a vypíše jejich součet (opět v hexadecimální tvaru).


Struktura a funkce biomakromolekul KBC/BPOL

Struktura a funkce biomakromolekul KBC/BPOL Struktura a funkce biomakromolekul KBC/BPOL 2. Posttranslační modifikace a skládání proteinů Ivo Frébort Biosyntéza proteinů Kovalentní modifikace proteinů Modifikace proteinu může nastat předtím než je


Usnesení 12. mimořádné schůze rady městského obvodu konané dne 31.03.2015. - 0437/RMObM-Sle/1418/12

Usnesení 12. mimořádné schůze rady městského obvodu konané dne 31.03.2015. - 0437/RMObM-Sle/1418/12 12. mimořádné schůze rady městského obvodu konané dne 31.03.2015 čís. 0435/RMObM-Sle/1418/12-0437/RMObM-Sle/1418/12 MVDr. Barbora Jelonková v.r. Starostka městského obvodu Ing. Roman Goryczka v.r. Místostarosta


Usnesení. z veřejného zasedání zastupitelstva obce Rohatec konaného dne v hod v Kulturním domě Rohatec

Usnesení. z veřejného zasedání zastupitelstva obce Rohatec konaného dne v hod v Kulturním domě Rohatec Usnesení z veřejného zasedání zastupitelstva obce Rohatec konaného dne 20. 4. 2016 v 17.00 hod v Kulturním domě Rohatec Zveřejněna je upravená verze dokumentu z důvodu dodržení přiměřenosti rozsahu zveřejňovaných


EEG Application for Emotiv

EEG Application for Emotiv 2014 EEG Application for Emotiv MANUÁL Obsah 1 Úvod... 2 2 Spuštění programu... 2 3 Zobrazení dat v reálném čase... 2 3.1 Patient Information... 2 3.2 Recording Information... 3 3.3 Start Recording...


OPVK CZ.1.07/2.2.00/28.0184

OPVK CZ.1.07/2.2.00/28.0184 OPVK CZ.1.07/2.2.00/28.0184 Drug-design - racionální návrh léčiv KFC/DD 03 molekulární cíl RNDr. Karel Berka, Ph.D. ZS 2012/2013 Motto Bez cíle se ani Robin Hood netrefí. Nejmenovaný autor tohoto kurzu


Usnesení 31. schůze rady městského obvodu konané dne

Usnesení 31. schůze rady městského obvodu konané dne 31. schůze rady městského obvodu konané dne 07.03.2016 čís. 0969/RMOb-MH/1418/31-0999/RMOb-MH/1418/31 Mgr. Patrik Hujdus 1. místostarosta městského obvodu RSDr. Jiří Boháč místostarosta městského obvodu


Regulace enzymových aktivit

Regulace enzymových aktivit Regulace enzymových aktivit Regulace enzymových aktivit: Změny množství enzymu v kompartmentu, buňce, orgánu: - změna exprese, degradace atd. - změna lokalizace Skutečné regulace: - aktivace/inhibice nízkomolekulárními


Usnesení 46. mimořádné schůze rady městského obvodu konané dne

Usnesení 46. mimořádné schůze rady městského obvodu konané dne 46. mimořádné schůze rady městského obvodu konané dne 25.05.2016 čís. 1935/RMObM-Sle/1418/46-1940/RMObM-Sle/1418/46 MVDr. Barbora Jelonková v.r. starostka městského obvodu Ing. Roman Goryczka v.r. místostarosta


Vytvoření pokročilé Fotogalerie v Drupalu - Views

Vytvoření pokročilé Fotogalerie v Drupalu - Views Vytvoření pokročilé Fotogalerie v Drupalu - Views Views Máme tři pohledy: gallery_photos, all_galeries, admin_gallery Buď je můžete vytvořit podle návodu níže, nebo importovat z přiložených txt souborů


2D standard pro jízdní doklady ČD, a.s.

2D standard pro jízdní doklady ČD, a.s. 2D standard pro jízdní doklady ČD, a.s. Základní pravidla a popis struktur Odbor informatiky České dráhy, a.s. Dne: 28.5.2012 Verze. 1.00 1. Úvod Dokument popisuje základní pravidla pro sestavení kontrolního


ČÉ Á ŠŤ šť š Č ř ž š ý Š Č Ú š ú š Ž š š š ř ž ž š š š š ý ř š š ů ř š š š š š ú Í ú ř š š ů š š Ž ř ž ů ý Ě É Ú Í Í Š Ě ÍÚ Í š š Ý ý š Ó Č ř ř ř š ř ý ř ž ř š Č Š ÉŽ š Ě Í š Ř Ě Š Ě Á Á ČÁ š ý ž ž š ý


Ing. Ladislav Pyskatý - tajemník Hana Plachá - zapisovatelka. Mgr. Radek Jehlička Mgr. Karel Štrégl

Ing. Ladislav Pyskatý - tajemník Hana Plachá - zapisovatelka. Mgr. Radek Jehlička Mgr. Karel Štrégl 1 Zápis z jednání Rdy měst v Rychnově nd Kněžnou ze dne 13.7.2015 Přítomni: Ing. Jn Skořep Mgr. Jn Drejslová MUDr. Hn Dvořáková JUDr. Miln Novák Ing. Ivn Skřítecká Ing. Ldislv Pysktý - tjemník Hn Plchá


ReatogoXPE, stručný průvodce

ReatogoXPE, stručný průvodce ReatogoXPE, stručný průvodce Autori : Pavel / Craft (11.7.2005) Tento návod vás provede vytvořením ReatogoXPE krok za krokem. Nezabývá se žádným nastavováním, jedná se pouze o základní


NMR biomakromolekul RCSB PDB. Progr. NMR

NMR biomakromolekul RCSB PDB. Progr. NMR NMR biomakromolekul Typy biomakromolekul a možnosti studia pomocí NMR proteiny a peptidy rozmanité složení, omezení jen velikostí molekul nukleové kyseliny (RNA, DNA) a oligonukleotidy omezení malou rozmanitostí


= 8 25 + 19 12 = 32 43 32 = 11. 2 : 1 k > 0. x k + (1 x) 4k = 2k x + 4 4x = 2 x = 2 3. 1 x = 3 1 2 = 2 : 1.

= 8 25 + 19 12 = 32 43 32 = 11. 2 : 1 k > 0. x k + (1 x) 4k = 2k x + 4 4x = 2 x = 2 3. 1 x = 3 1 2 = 2 : 1. 4 4 = 8 8 8 = 5 + 19 1 = 4 = 11 : 1 k > 0 k 4k x 1 x x k + (1 x) 4k = k x + 4 4x = x = x 1 x = 1 = : 1. v h h s 75 v 50 h s v v 50 s h 75 180 v h 90 v 50 h 180 90 50 = 40 s 65 v 80 60 80 80 65 v 50 s 50


Metody práce s proteinovými komplexy

Metody práce s proteinovými komplexy Metody práce s proteinovými komplexy Zora Nováková, Zdeněk Hodný Proteinové komplexy tvořeny dvěma a více proteiny spojenými nekovalentními vazbami Van der Waalsovy síly vodíkové můstky hydrofobní interakce


HTT-102 DVB-T HD modulátor

HTT-102 DVB-T HD modulátor HTT-102 DVB-T HD modulátor HTT-101 slouží k převodu nekomprimovaného obrazového a zvukového signálu v digitálním formátu připojeného na rozhraní HDMI na komprimovaný transportní tok MPEG-4 HD (H.264) a


České dráhy a.s. Generální ředitelství. Rozkaz. o doprovodu vlaků vlakovými četami. sešit 2. Krajské centrum Olomouc, Ostrava, Zlín

České dráhy a.s. Generální ředitelství. Rozkaz. o doprovodu vlaků vlakovými četami. sešit 2. Krajské centrum Olomouc, Ostrava, Zlín České dráhy a.s. Generální ředitelství Rozkaz o doprovodu vlaků vlakovými četami sešit 2 Krajské centrum Olomouc, Ostrava, Zlín Účinnost od 11. prosince 2005 Jen pro služební potřebu České dráhy Generální


Natural Language Toolkit

Natural Language Toolkit Natural Language Toolkit prezentace do předmětu PA154 Nástroje pro korpusy část 1 možnosti NLTK Stručná charakteristika NLTK je sada knihoven pro Python a programů pro symbolické a statistické zpracování


Neřízené usměrňovače reálné vlastnosti

Neřízené usměrňovače reálné vlastnosti Počítačové cvičení BNEZ 1 Neřízené usměrňovače reálné vlastnosti Úkol 1: Úkol 2: Úkol 3: Úkol 4: Úkol 5: Pomocí programu OrCAD Capture zobrazte voltampérovou charakteristiku diody 1N4007 pro rozsah napětí


Mechanika II.A Třetí domácí úkol

Mechanika II.A Třetí domácí úkol Mechanika II.A Třetí domácí úkol (Zadání je částečně ze sbírky: Lederer P., Stejskal S., Březina J., Prokýšek R.: Sbírka příkladů z kinematiky. Skripta, vydavatelství ČVUT, 2003.) Vážené studentky a vážení


Modelování webových služeb v UML

Modelování webových služeb v UML Modelování webových služeb v UML Jaromír Šveřepa LBMS, s.r.o. Abstrakt: Tento příspěvek se zaměřuje na praktický postup pro identifikaci potřeby webové služby, modelování způsobu jejího použití, popřípadě


4. Centrální dogma, rozluštění genetického kódu a zrod molekulární biologie.

4. Centrální dogma, rozluštění genetického kódu a zrod molekulární biologie. 4. Centrální dogma, rozluštění genetického kódu a zrod molekulární biologie. Od genu k proteinu - centrální dogma biologie Geny jsou zakódovány v DNA - Jakým způsobem? - Jak se projevují? Již v roce 1902


Bioinformatika. Jiří Vondrášek Ústav organické chemie a biochemie Jan Pačes Ústav molekulární genetiky

Bioinformatika. Jiří Vondrášek Ústav organické chemie a biochemie Jan Pačes Ústav molekulární genetiky Bioinformatika pro PrfUK 2006 Jiří Vondrášek Ústav organické chemie a biochemie Jan Pačes Ústav molekulární genetiky syllabus Úterý,


Blast Rozhraní DeviceNet

Blast Rozhraní DeviceNet Blast Rozhraní DeviceNet Verze: 1.0 27/09/2001 BLAST-E MNU 0030 MANUÁL DNetBlast JKO MEZ CZ s.r.o. ELEKTROPOHONY Oficiální zastoupení firem REEL S.r.l. a EARP s.p.a Hájecká 2 618 00 Brno-Černovice Tel./fax


MĚSTSKÁ ČÁST PRAHA 3 Zastupitelstvo městské části U S N E S E N Í

MĚSTSKÁ ČÁST PRAHA 3 Zastupitelstvo městské části U S N E S E N Í č.j.: 1049/2015 MĚSTSKÁ ČÁST PRAHA 3 Zastupitelstvo městské části U S N E S E N Í č. 158 ze dne 22.12.2015 Prodej nemovité věci dle zák. č. 89/2012 Sb., občanský zákoník, v platném znění - pronajatých


Big Data. Josef Šlerka, Ataxo Interactive, SNM FF UK Business & Information Forum 2011, Praha

Big Data. Josef Šlerka, Ataxo Interactive, SNM FF UK Business & Information Forum 2011, Praha Big Data Josef Šlerka, Ataxo Interactive, SNM FF UK Business & Information Forum 2011, Praha 3 000 000 000 počet hledání na Googlu denně 30 000 000 000 počet zpráv a příspěvků na Facebooku měsíčně 5 000


Studijní materiály pro bioinformatickou část ViBuChu. úloha II. Jan Komárek, Gabriel Demo

Studijní materiály pro bioinformatickou část ViBuChu. úloha II. Jan Komárek, Gabriel Demo Studijní materiály pro bioinformatickou část ViBuChu úloha II Jan Komárek, Gabriel Demo Adenin Struktura DNA Thymin 5 konec 3 konec DNA tvořena dvěmi řetězci orientovanými antiparalelně (liší se orientací


Regulace translace REGULACE TRANSLACE LOKALIZACE BÍLKOVIN V BUŇCE. 4. Lokalizace bílkovin v buňce. 1. Translační aparát. 2.

Regulace translace REGULACE TRANSLACE LOKALIZACE BÍLKOVIN V BUŇCE. 4. Lokalizace bílkovin v buňce. 1. Translační aparát. 2. Regulace translace 1. Translační aparát 2. Translace 3. Bílkoviny a jejich posttranslační modifikace a jejich degradace 5. Translace v mitochondriích a chloroplastech REGULACE TRANSLACE LOKALIZACE BÍLKOVIN


ANT. Aplikační programování v Javě (BI-APJ) - 1 Ing. Jiří Daněček Katedra softwarového inženýrství Fakulta informačních technologií ČVUT Praha

ANT. Aplikační programování v Javě (BI-APJ) - 1 Ing. Jiří Daněček Katedra softwarového inženýrství Fakulta informačních technologií ČVUT Praha ANT Aplikační programování v Javě (BI-APJ) - 1 Ing. Jiří Daněček Katedra softwarového inženýrství Fakulta informačních technologií ČVUT Praha Evropský sociální fond Praha & EU: Investujeme do vaší budoucnosti


Vibrační. 112 Přehled VEGASWING 114 VEGASWING 51. 116 VEGASWING série 60. 124 Přehled VEGAVIB. 126 VEGAVIB série 60. 134 Přehled VEGAWAVE

Vibrační. 112 Přehled VEGASWING 114 VEGASWING 51. 116 VEGASWING série 60. 124 Přehled VEGAVIB. 126 VEGAVIB série 60. 134 Přehled VEGAWAVE Vibrační 112 Přehled VEGASWING 114 VEGASWING 51 116 VEGASWING série 60 124 Přehled VEGAVIB 126 VEGAVIB série 60 134 Přehled VEGAWAVE 136 VEGAWAVE série 60 111 Přehled VEGASWING Oblast použití Limitní spínače


Usnesení z 26. schůze Rady města Bechyně konané dne 23. 10. 2013 (usnesení č. 325-336)

Usnesení z 26. schůze Rady města Bechyně konané dne 23. 10. 2013 (usnesení č. 325-336) Usnesení z 26. schůze Rady města Bechyně konané dne 23. 10. 2013 (usnesení č. 325-336) USNESENÍ č. 325/26-13 R uzavřít s xxxxxxxxxxxxxxxxxxxxxx, nar. xxxxxxxxxxx, novou smlouvu o nájmu bytu č. 4 o velikosti


Usnesení z 26. schůze Rady města Bechyně konané dne 7. 12. 2015 (usnesení č. 345-359)

Usnesení z 26. schůze Rady města Bechyně konané dne 7. 12. 2015 (usnesení č. 345-359) Usnesení z 26. schůze Rady města Bechyně konané dne 7. 12. 2015 (usnesení č. 345-359) USNESENÍ č. 345/26-15 R I. r o z h o d l a přidělit byt č. 10 o velikosti 2+1 ve třetím podlaží domu čp. 640 v Bechyni


Lodish et al, Molecular Cell Biology, 4-6 vydání Alberts et al, Molecular Biology of the Cell, 4 vydání

Lodish et al, Molecular Cell Biology, 4-6 vydání Alberts et al, Molecular Biology of the Cell, 4 vydání Lodish et al, Molecular Cell Biology, 4-6 vydání Alberts et al, Molecular Biology of the Cell, 4 vydání CHEMICKÉ SLOŽENÍ BUŇKY BUŇKA: 99 % C, H, N,


Usnesení 23. zasedání zastupitelstva městského obvodu konaného dne 26.06.2014. - 0589/ZMOb-Sle/1014/23

Usnesení 23. zasedání zastupitelstva městského obvodu konaného dne 26.06.2014. - 0589/ZMOb-Sle/1014/23 23. zasedání zastupitelstva městského obvodu konaného dne 26.06.2014 čís. 0569/ZMOb-Sle/1014/23-0589/ZMOb-Sle/1014/23 MUDr. Hana Heráková Místostarostka Ing. Petr Janíček Místostarosta Strana 1/14 Přehled


Rada MČ Brno-Černovice

Rada MČ Brno-Černovice 1 RADA MĚSTSKÉ ČÁSTI, BOLZANOVA 1, 618 00 BRNO USNESENÍ 47. schůze Rady městské části Brno-Černovice konané dne 29. 6. 2016 od 15.00 hod. na ÚMČ Brno-Černovice, Bolzanova 1, Brno (kancelář starosty) Rada


Ant aneb Ferda Mravenec, práce všeho druhu

Ant aneb Ferda Mravenec, práce všeho druhu Ant aneb Ferda Mravenec, práce všeho druhu Nástroj na sestavování projektů (aplikací) podobný programu make, který se používá u programů v C či C++. Program Ant je volně k dispozici (tzv. The Apache Software


Fragment based drug design

Fragment based drug design Fragment based drug design O E115 H114 K91 S161 R93 Q173 D171 OH NH 2 NH 2 O Cdk6 FGFR HGF N BRCA2 Proteiny buňkových regulačních systémů, ve kterých léčiva zasahují do interakcí protein-protein Fragmenty


První krůčky se SAS Enterprise Miner 6.2. Zaškrtněte Personal Workstation a přihlašte se jako localhost\sasdemo.

První krůčky se SAS Enterprise Miner 6.2. Zaškrtněte Personal Workstation a přihlašte se jako localhost\sasdemo. Zaškrtněte Personal Workstation a přihlašte se jako localhost\sasdemo. New Project Pojmenujte projekt a vyberte fyzickou cestu adresář na disku (s právem zápisu pro uživatele sasdemo), kde budou uložena


Pokročilé Webové služby a Caché security. Š. Havlíček

Pokročilé Webové služby a Caché security. Š. Havlíček Pokročilé Webové služby a Caché security Š. Havlíček Webové služby co se tím míní? Webová služba metoda komunikace mezi dvěma elektronickými zařízeními přes internet Typicky jsou pomocí rozhraní přístupné


Válec pístní tyče Normované válce ISO 15552, série TRB. Katalogová brožurka

Válec pístní tyče Normované válce ISO 15552, série TRB. Katalogová brožurka ISO 15552, série TRB Katalogová brožurka 2 ISO 15552, série TRB Válec zakotvení Přípoje: G 1/8 - G 1/2 Dvojčinný S magnetickým pístem Tlumení: pneumaticky, nastavitelný Pístní tyč: Vnější závit Volitelně


ž ě č Č š ě ě ž Ě š š ě Š ě ě ě ž ů ě Ě ě Š č ě č č ž č č Č Ě š Ě š ě ě š ě ě ě ž Ů ě č ě Š Š č ž Ý Óž Ó č ÝŠ č š ú ě š č č č šť Š šť šť Ú ú ů Š Ú ů ú Š ž ě ě ě ů ě ě ě ů ě ě ž ů ě ů ž ž ě č ě č ě č ů


Má tajemný clusterin u dětí v septickém stavu aktivitu chaperonu? J. Žurek, P.Košut, M. Fedora

Má tajemný clusterin u dětí v septickém stavu aktivitu chaperonu? J. Žurek, P.Košut, M. Fedora Má tajemný clusterin u dětí v septickém stavu aktivitu chaperonu? J. Žurek, P.Košut, M. Fedora Klinika dětské anesteziologie a resuscitace, Lékařská fakulta MU, Fakultní nemocnice Brno DNA transkripce


Internetové školení opatření k uspokojení potřeb zákazníka

Internetové školení opatření k uspokojení potřeb zákazníka Internetové školení opatření k uspokojení potřeb zákazníka Březen, 2007 Přezkoumání 01 30.03.2007 Spokojenost zákazníka Spokojený zákazník je velmi důležitým základem pro další rozvoj: Spokojený zákazník


Usnesení 12. schůze rady městského obvodu konané dne 15.04.2015

Usnesení 12. schůze rady městského obvodu konané dne 15.04.2015 12. schůze rady městského obvodu konané dne 15.04.2015 čís. 0295/RMOb-Vit/1418/12-0320/RMOb-Vit/1418/12 Petr Dlabal starosta Mgr. Petr Kutěj místostarosta Strana 1 Přehled usnesení rady městského obvodu


Možnosti využití technologie DNA microarrays v predikci odpovědi na neoadjuvantní terapii u pacientů s karcinomem jícnu

Možnosti využití technologie DNA microarrays v predikci odpovědi na neoadjuvantní terapii u pacientů s karcinomem jícnu Možnosti využití technologie DNA microarrays v predikci odpovědi na neoadjuvantní terapii u pacientů s karcinomem jícnu Srovnal J. 1, Cincibuch J. 2, Cwierkta K. 2, Melichar B. 2, Aujeský R. 3, Vrba R.


BDVR 2.5. Návod na použití

BDVR 2.5. Návod na použití Vážený zákazníku! Děkujeme Vám, za zakoupení přenosného záznamového zařízení DVR. Před použitím si pozorně přečtěte tento návod na použití. Popis Zařízení 2 1) SD slot 2) Zelená LED (spuštěné zařízení)


Využití NMR spektroskopie pro studium biomakromolekul RCSB PDB

Využití NMR spektroskopie pro studium biomakromolekul RCSB PDB Využití NMR spektroskopie pro studium biomakromolekul RCSB PDB Uplatnění NMR spektroskopie chemická struktura kovalentní struktura konformace, geometrie molekul dynamické procesy chemické a konformační


Přehled a definice seznamů

Přehled a definice seznamů Přehled a definice seznamů Verze 2009 05 05 L{P1} Project Repositories Listing Popis: Přehled všech vytvořených Repository komponent v daném Projectu; Skupina: Project Components; Titulek: Components:


Dána geometrickým uspořádáním polypeptidového řetězce

Dána geometrickým uspořádáním polypeptidového řetězce Otázka: Bílkoviny Předmět: Chemie Přidal(a): denisa Základní stavební jednotka živé hmoty, přítomné ve všech buňkách. Složení: z 20 základních aminokyselin Funkce: Stavební- kolagen-chrupavky, elastin-el.vazivo,


Základy redakční práce. Eva Juláková Tel:

Základy redakční práce. Eva Juláková   Tel: Základy redakční práce Eva Juláková E-mail: Tel: 607 565 211 Základní práce s textem o redakční práci obecně o odborné redakci názvosloví matematické zápisy výčty, tabulky, obrázky



WinFast TV2000 XP HARDWARE GUIDE. Obsah WinFast TV2000 XP HARDWARE GUIDE Obsah Součásti balení Specifikace Systémové požadavky Odebrání starších ovladačů a aplikací Hardwarová instalace Připojení vstup/výstup zařízení Instalace aplikace a ovladačů


Obecné principy chemických strukturních bází dat předmět projektu VaVpI ChemEIZ

Obecné principy chemických strukturních bází dat předmět projektu VaVpI ChemEIZ Obecné principy chemických strukturních bází dat předmět projektu VaVpI ChemEIZ Jaroslav Šilhánek Strukturní báze dat = Grafická representace struktur chemických sloučenin (+ další informace) Reakční


Vazebné interakce protein s DNA

Vazebné interakce protein s DNA Vazebné interakce protein s DNA Vazebné možnosti vn jší vazba atmosféra + iont kolem nabité DNA vazba ve žlábku van der Waalsovský kontakt s lé ivem ve žlábku interkalace vmeze ení planárního aromat.


Sínusový měnič napětí s funkcí UPS WT 1000-3000

Sínusový měnič napětí s funkcí UPS WT 1000-3000 Sínusový měnič napětí s funkcí UPS WT 1000-3000 Pozor: Vysoké napětí- nikdy neotvírejte přístroj 1- připojte měnič ke správnému DC napětí 12-24-48V, připojovací kabely musí být co nejkratší příliš dlouhé


14/10/2015 Z Á K L A D N Í C E N Í K Z B O Ž Í Strana: 1

14/10/2015 Z Á K L A D N Í C E N Í K Z B O Ž Í Strana: 1 14/10/2015 Z Á K L A D N Í C E N Í K Z B O Ž Í Strana: 1 S Á ČK Y NA PS Í E XK RE ME N TY SÁ ČK Y e xk re m en t. p o ti sk P ES C Sá čk y P ES C č er né,/ p ot is k/ 12 m y, 20 x2 7 +3 c m 8.8 10 bl ok


Chromatofokusace. separace proteinů na základě jejich pi vysoké rozlišení. není potřeba připravovat ph gradient zaostřovací efekt jednoduchost

Chromatofokusace. separace proteinů na základě jejich pi vysoké rozlišení. není potřeba připravovat ph gradient zaostřovací efekt jednoduchost Chromatofokusace separace proteinů na základě jejich pi vysoké rozlišení není potřeba připravovat ph gradient zaostřovací efekt jednoduchost Polypufry - amfolyty Stacionární fáze Polybuffer 96 - ph 9-6


Návod na použití Dveřní jednotka DJ 1T, DJ 2T Stránka 1

Návod na použití Dveřní jednotka DJ 1T, DJ 2T Stránka 1 DJ 1T v2, DJ2T v2 Návod na použití Návod na použití Dveřní jednotka DJ 1T, DJ 2T Stránka 1 Mechanické části a jejich funkce Připojení kabelů Hlavní port pro připojení DJ: BUS: Připojení k nepolarizované


ř ý š ř ů Ť ň ř š ú ú ř š ř ř ř š š ř ů ů ř š ý ý ř š ů ů ů ý Žš ý Ž ý ý ý ý š ů ů šř ř ýš ř ž ý ý šť ž ž ý šť ř š š ř š ř ý ů Ž ýš ú š ů š ž ý ý ž ž š ý š ý ř š ý ů ý ř š ů š ó ř ýš ž ý ý š ř ů ž ý ý


Communist Party of Nepal (Unified Marxist-Leninist) Unified Modeling Language University of Massachusetts Lowell User-mode Linux.

Communist Party of Nepal (Unified Marxist-Leninist) Unified Modeling Language University of Massachusetts Lowell User-mode Linux. Jan Smolík UML UML Communist Party of Nepal (Unified Marxist-Leninist) Unified Modeling Language University of Massachusetts Lowell User-mode Linux Zdroj: Wikipedia Unified modelling language Neproprietární


Revit link. Propojení mezi Scia Engineer a Revit structure

Revit link. Propojení mezi Scia Engineer a Revit structure Propojení mezi Scia Engineer a Revit structure Tento dokument je určen pouze uživatelům produktů firmy SCIA s platnou licencí pro informační účely a je poskytován "tak jak je", to je bez jakýchkoliv záruk,


U s n e s e n í ze zasedání Zastupitelstva města Bechyně konaného dne

U s n e s e n í ze zasedání Zastupitelstva města Bechyně konaného dne U s n e s e n í ze zasedání Zastupitelstva města Bechyně konaného dne 12. 9. 2012 USNESENÍ č. 50/6-12 Z 1. Rozpočtové opatření č. 34/2012 pol.4122 neinvestiční přijaté transfery od krajů ve výši 35.000,-


Ing. Ladislav Pyskatý - tajemník Jaroslava Pleslová - zapisovatelka

Ing. Ladislav Pyskatý - tajemník Jaroslava Pleslová - zapisovatelka 1 Zápis z jednání Rady města v Rychnově nad Kněžnou ze dne 5.10.2015 Přítomni: Ing. Jan Skořepa Mgr. Jana Drejslová JUDr. Milan Novák Ing. Ivana Skřítecká Mgr. Radek Jehlička MUDr. Hana Dvořáková Mgr.



PŘENOS SIGNÁLU DO BUŇKY, MEMBRÁNOVÉ RECEPTORY PŘENOS SIGNÁLU DO BUŇKY, MEMBRÁNOVÉ RECEPTORY 1 VÝZNAM MEMBRÁNOVÝCH RECEPTORŮ V MEDICÍNĚ Příklad: Membránové receptory: adrenergní receptory (receptory pro adrenalin a noradrenalin) Funkce: zprostředkování



AirKIT TECHNICKÝ MANUÁL. TnG-AirKIT. Power. Run TnG-Air AirKIT + TnG-AirKIT - ok Power Run TECHNICKÝ MANUÁL 2. 1. ELEKTRICKÉ POPIS OVLÁDACÍCH ZAPOJENÍ PRVKŮ 1.1. AirKIT mod.2012 ovládací prvky 1 5 4 3 + TnG-AirKIT - Power ok Run 7 6 AirKIT ovládací


Usnesení 98. schůze rady městského obvodu konané dne 18.12.2013

Usnesení 98. schůze rady městského obvodu konané dne 18.12.2013 98. schůze rady městského obvodu konané dne 18.12.2013 čís. 2889/RMOb-Vit/1014/98-2932/RMOb-Vit/1014/98 Petr Dlabal starosta MUDr. Jindřich Prokop místostarosta Strana 1 Přehled usnesení rady městského


Usnesení 84. schůze rady městského obvodu konané dne 05.06.2013

Usnesení 84. schůze rady městského obvodu konané dne 05.06.2013 84. schůze rady městského obvodu konané dne 05.06.2013 čís. 2413/RMOb-Vit/1014/84-2424/RMOb-Vit/1014/84 Petr Dlabal starosta Ing. Leoš Adamík místostarosta Strana 1 Přehled usnesení rady městského obvodu


ZÁSADY PRO UZAVÍRÁNÍ SMLUV týkajících se inženýrských sítí, drobných a jiných staveb na pozemcích města Veselí nad Moravou

ZÁSADY PRO UZAVÍRÁNÍ SMLUV týkajících se inženýrských sítí, drobných a jiných staveb na pozemcích města Veselí nad Moravou č. j. MVNM/30173/2015 ZÁSADY PRO UZAVÍRÁNÍ SMLUV týkajících se inženýrských sítí, drobných a jiných staveb na pozemcích města Veselí nad Moravou I. ÚČEL Tyto Zásady pro uzavírání smluv týkajících se inženýrských


Digitální učební materiál

Digitální učební materiál Digitální učební materiál Projekt Šablona Tématická oblast DUM č. CZ.1.07/1.5.00/34.0415 Inovujeme, inovujeme III/2 Inovace a zkvalitnění výuky prostřednictvím ICT (DUM) Anglický jazyk pro obor podnikání


CertReview Uživatelská příručka

CertReview Uživatelská příručka CertReview Uživatelská příručka Služba CertReview slouží k on-line ověření elektronických podpisů a kvalifikovaných certifikátů. Je založena na vyhodnocení platnosti proti seznamům zneplatněných certifikátů


Usnesení. Usnesení 60. schůze rady městského obvodu konané dne 30.05.2013. 3360/RMOb-Sle/1014/60-3429/RMOb-Sle/1014/60

Usnesení. Usnesení 60. schůze rady městského obvodu konané dne 30.05.2013. 3360/RMOb-Sle/1014/60-3429/RMOb-Sle/1014/60 60. schůze rady městského obvodu konané dne 30.05.2013 čís. 3360/RMOb-Sle/1014/60-3429/RMOb-Sle/1014/60 Ing. Antonín Maštalíř starosta MUDr. Hana Heráková místostarostka Strana 1/50 Přehled usnesení rady


Výukový materiál zpracován v rámci projektu EU peníze školám Registrační číslo projektu: CZ.1.07/1.5.00/34.0996

Výukový materiál zpracován v rámci projektu EU peníze školám Registrační číslo projektu: CZ.1.07/1.5.00/34.0996 Výukový materiál zpracován v rámci projektu EU peníze školám Registrační číslo projektu: CZ.1.07/1.5.00/34.0996 Šablona: III/2 č. materiálu: VY_32_INOVACE_CHE_413 Jméno autora: Mgr. Alena Krejčíková Třída/ročník:
