Genomické databáze. Shlukování proteinových sekvencí. Ivana Rudolfová. školitel: doc. Ing. Jaroslav Zendulka, CSc.

Save this PDF as:

Rozměr: px
Začít zobrazení ze stránky:

Download "Genomické databáze. Shlukování proteinových sekvencí. Ivana Rudolfová. školitel: doc. Ing. Jaroslav Zendulka, CSc."


1 Genomické databáze Shlukování proteinových sekvencí Ivana Rudolfová školitel: doc. Ing. Jaroslav Zendulka, CSc.

2 Obsah Proteiny Zdroje dat Predikce struktury proteinů Cíle disertační práce Vstupní data Shlukování proteinů 1. metoda Shlukování proteinů založené na hustotě Shrnutí

3 Proteiny Nejrůznější funkce: stavební funkce (kolagen) katalyzátory chemických reakcí (enzymy) transport látek v organismu (hemoglobin) pohybová (myosin) zásobní (ferritin) signální (insulin) receptory (rhodopsin) regulace genové exprese Složitá 3D struktura vzniká po vytvoření peptidického vlákna (protein folding)

4 Proteiny Protein sekvence aminokyselin, řetězec nad abecedou aminokyselin Složení aminokyselin: aminoskupina, alfa uhlík, karboxylová skupina Aminokyseliny: hodrofobní, polární, aminokyseliny s nábojem Sekvence aminokyselin = primární struktura proteinu Primární struktura určuje fyzikální a chemické vlastnosti proteinu, jeho prostorovou strukturu a biologickou funkci

5 Proteiny

6 Proteiny

7 Proteiny Atomy mimo postranní řetězce kostra proteinu Délky vazeb a planární vazebné úhly vazeb atomů páteře proteinu jsou víceméně pevné Ohebnost páteře proteinu je odvozena od torzních úhlů φ a ψ Nejběžnější lokální struktury: α-helix, β-sheet

8 Proteiny

9 Proteiny Oblasti sekundární struktury a méně strukturované oblasti vytváří celkový prostorový tvar proteinu terciární struktura Kvartérní struktura komplex tvořený více proteinovými řetězci

10 Obsah Proteiny Zdroje dat Predikce struktury proteinů Cíle disertační práce Vstupní data Shlukování proteinů 1. metoda Shlukování proteinů založené na hustotě Shrnutí

11 Zdroje dat Primární databáze biologických dat: databáze sekvencí nukleotidů (EMBL-Bank, DDBJ) databáze sekvencí proteinů (Swiss-Prot, TrEMBL) databáze struktur proteinů (PDB, MSD) genomové databáze (Ensembl) databáze s informacemi o expresi genů (ArrayExpress) Sekundární databáze: informace získané analýzou dat v primárních databázích (Prosite, Blocks)

12 Obsah Proteiny Zdroje dat Predikce struktury proteinů Cíle disertační práce Vstupní data Shlukování proteinů 1. metoda Shlukování proteinů založené na hustotě Shrnutí

13 Predikce struktury proteinů pokud dokážeme odhadnout strukturu proteinů, můžeme odhadnout i jejich funkci molekula zaujme prostorovou konfiguraci na základě přitažlivých a odpudivých sil jednotlivých atomů (konfigurace s nejmenší energií) strukturu je možné určit pouze na základě těchto sil příliš výpočetně složité

14 Predikce struktury proteinů Modelování struktury na základě homologie (porovnávání primárních struktur, databáze sekvencí, nástroje BLAST) Threading (porovnání energetické výhodnosti uspořádání sekvence do jednotlivých známých struktur, rodiny proteinů) Ab initio modelování (modelování na základě energetické výhodnosti) Skládání ze sekvenčně-strukturních fragmentů (I-sites library, Ch. Bystroff a D. Baker )

15 Sekvenčně-strukturní fragmenty APSKPDNP CPSKPDNP APSKPENP. LITRQR LVTRQR VITRQR prostor sekvencí prostor struktur

16 Obsah Proteiny Zdroje dat Predikce struktury proteinů Cíle disertační práce Vstupní data Shlukování proteinů 1. metoda Shlukování proteinů založené na hustotě Shrnutí

17 Cíle disertační práce nalezení shlukovací metody, která umožní nalézt takové skupiny sekvencí aminokyselin, které se v přírodě vyskytují v omezeném počtu strukturních elementů získání vhodných vstupních dat pro shlukování ověření existence těchto sekvencí nalezení vzdálenostní funkce pro hodnocení podobnosti sekvencí shlukování sekvencí

18 Obsah Proteiny Zdroje dat Predikce struktury proteinů Cíle disertační práce Vstupní data Shlukování proteinů 1. metoda Shlukování proteinů založené na hustotě Shrnutí

19 Vstupní data zdroj dat: databáze PDB výběr záznamů z PDB: sekvence pod 40% podobnosti rozlišení lepší než 2,5Å ( ATOM 61 N THR A N ATOM 62 CA THR A C ATOM 63 C THR A C ATOM 64 O THR A O ATOM 65 CB THR A C ATOM 66 OG1 THR A O ATOM 67 CG2 THR A C ATOM 68 N LEU A N ATOM 69 CA LEU A C

20 Vstupní data výpočet torzních úhlů φ, ψ a ω pro jednotlivé AK (torsion.c) pdb1aba.ent PHI PSI OMEGA MET PHE LYS VAL TYR GLY TYR ASP SER

21 Vstupní data konverze souborů s torzními úhly na: soubor s kódy AK (1 znak) soubor s kódy pro úhly jednotlivých AK (5 znaků) soubor s názvy pdb souborů #***MFKVYGYDSNIHKCGPCDNAKRLLTVKKQPF EFINIMPEKGVFDDEKIAELLTKLGRDTQIGLTMP QVFAPDGSHIGGFDQLREYFK#****KNSLLEKR #####***************Mxx65M2166M1261 M1158M1762M0104M1365M2060M2232M2230 M1626M0758M2461M0653M2426M2528M2326 M2228M2328M2326M2426M2229M2327M2328 M2326 pdb1aba.ent pdb1afw.ent pdb1agj.ent pdb1aho.ent pdb1ah7.ent pdb1aie.ent pdb1ajs.ent

22 Vstupní data Vytvoření databáze se vstupními daty tabulky pro délku sekvencí: 4 14 AK ID, sekvence, struktura, pdb soubor 58 AAAA M2426M2226M2428M2328 pdb1o66 59 AAAA M2327M2326M2227M2229 pdb1rm6 60 AAAA M2327M2426M2327M2327 pdb1rm6 61 AAAA M2327M2326M2327M2327 pdb1svd 62 AAAA M2227M2327M2328M1541 pdb1tca 63 AAAA M2227M2327M2327M2227 pdb1tca 64 AAAA M2128M2227M2327M2327 pdb1uuq 65 AAAA M2428M2228M2227M2328 pdb1u4b

23 Obsah Proteiny Zdroje dat Predikce struktury proteinů Cíle disertační práce Vstupní data Shlukování proteinů 1. metoda Shlukování proteinů založené na hustotě Shrnutí

24 Shlukování proteinů 1. metoda nalezení všech struktur pro všechny sekvence AK (délka 4 až 14) shlukování nalezených struktur počet různých prostorových konformací pro danou sekvenci AK podobné struktury hodnoty úhlů φ a ψ se nacházejí v sousedních polích Ramachandrovy mapy výstup: sekvence AK nalezeny min. 10x počet shluků struktur <

25 Shlukování proteinů 1. metoda ALALEUALAALAPHEALA: nalezeno 24 x pocet konformaci 1 ALATYRILEGLNTHRARG: nalezeno 22 x pocet konformaci 2 ARGGLYALAASPTHRARG: nalezeno 22 x pocet konformaci 4 ARGPHELYSASPGLUILE: nalezeno 24 x pocet konformaci 2 ASNTRPGLYTHRASPLEU: nalezeno 24 x pocet konformaci 2 ASPGLUILETHRARGGLU: nalezeno 24 x pocet konformaci 2 ASPGLYVALASNVALILE: nalezeno 22 x pocet konformaci 2 ASPLEUGLYMETGLUSER: nalezeno 24 x pocet konformaci 2 ASPLEUILEPROSERMET: nalezeno 24 x pocet konformaci 2 ASPLYSGLYGLUVALLEU: nalezeno 22 x pocet konformaci 3 ASPSERALAALALEUALA: nalezeno 24 x pocet konformaci 2 GLNGLUTYRLEUASPSER: nalezeno 24 x pocet konformaci

26 Shlukování proteinů 1. metoda LEUARGSERTYRASP: nalezeno 14 x pocet konformaci 1 LEUARGSERTYRASPGLN: nalezeno 14 x pocet konformaci 1 LEUARGSERTYRASPGLNHIS: nalezeno 14 x pocet konformaci 1 LEUARGSERTYRASPGLNHISMET: nalezeno 14 x pocet konformaci 1 LEUARGSERTYRASPGLNHISMETASN: nalezeno 14 x pocet konformaci 1 LEUARGSERTYRASPGLNHISMETASNLEUVAL: nalezeno 14 x pocet konformaci 1 LEUARGSERTYRASPGLNHISMETASNLEUVALLEUSER: nalezeno 14 x pocet konformaci 1 LEUARGSERTYRASPGLNHISMETASNLEUVALLEUSERASP: nalezeno 14 x pocet konformaci

27 Shlukování proteinů 1. metoda Délka sekvence Počet cílových sekvencí Celkový počet sekvencí Teoreticky možný počet sekvencí ,10e ,54e ,66e ,98e ,15e ,22e ,00e ,72e ,83e ,90e ,37e

28 Slukování proteinů 1. metoda ASNLEUVALLYSGLYLEUALAALAGLU: nalezeno 12 x pocet konformaci 1 A2128MA2427MA2527MA2227MA2327MA2226MA2428MA2426MA2030M ASNSERLEUARGLYSLEUALAILEGLU: nalezeno 12 x pocet konformaci 1 A2326MA2427MA2227MA2426MA2328MA2228MA2327MA2327MA2327M skóre:

29 Obsah Proteiny Zdroje dat Predikce struktury proteinů Cíle disertační práce Vstupní data Shlukování proteinů 1. metoda Shlukování proteinů založené na hustotě Shrnutí

30 Shlukování proteinů založené na hustotě Shluky = oblasti s velkou hustotou objektů v prostoru dat oddělené oblastmi s malou hustotou vyskytujících se objektů Shluky různých tvarů Jsou schopné vypořádat se s výskytem šumu a odlehlých hodnot v datech Využití distribučních funkcí hustoty Funkce vlivu odvozená od vzdálenosti mezi dvěma objekty f Gauss ( x y) ( x, y ) d 2 2σ, = e 2 ( x, y) ( x y) 0 pro d f Square ( x, y) = 1 pro d, > σ σ

31 Shlukování proteinů založené na hustotě

32 Shlukování proteinů založené na hustotě

33 Shlukování proteinů založené na hustotě

34 Shlukování proteinů založené na hustotě 1kifA 3 3 VVVIGAGVI 3grs _ 23 EEEE SHH nhp_ VVVIGSGYI 3grs _ 23 EEEE SHH dldA VGVVGTGHI 3grs _ 23 EEEE SHH nacA VGTVAAGRI 3grs _ 23 EEEE SHH grs_ SVIVGAGYI 3grs _ 23 EEEE SHH psdA LGIIGYGHI 3grs _ 23 EEEE SHH nhp_ 3 3 VIVLGSSHG 3grs _ 23 EEEE SHH pbe_ 5 5 VAIIGAGPS 3grs _ 23 EEEE SHH ldtA ITVVGVGAV 3grs _ 23 EEEE SHH fcdA 5 5 VVVVGGGTG 3grs _ 23 EEEE SHH pgd_ 5 5 IALIGLAVM 3grs _ 23 EEEE SHH grs_ 6 23 YLVIGGGSG 3grs _ 23 EEEE SHH cox_ ALVIGSGYG 3grs _ 23 EEEE SHH tmdA VLIVGAGPS 3grs _ 23 EEEE SHH gadO 4 3 VGINGFGRI 3grs _ 23 EEEE SHH cdoA CAVFGLGAV 3grs _ 23 EEEE SHH din_ VGLVGYXLG 3grs _ 23 EEEE SHH ncfA LCLNGTVHL 3grs _ 23 EEEE SHH

35 Shlukování proteinů založené na hustotě

36 Obsah Proteiny Zdroje dat Predikce struktury proteinů Cíle disertační práce Vstupní data Shlukování proteinů 1. metoda Shlukování proteinů založené na hustotě Shrnutí

37 Shrnutí Vytvořena databáze se vstupními daty (sekvence délky 4 14 AK) Shlukování proteinů pomocí 1. metody: -ověření existence sekvenčně-strukturních fragmentů Shlukování proteinů založené na hustotě: - funkce vlivu - propojení shluků pro jednotlivé pozice Databáze nalezených sekvenčně strukturních fragmentů

Výukový materiál zpracován v rámci projektu EU peníze školám Registrační číslo projektu: CZ.1.07/1.5.00/34.0996

Výukový materiál zpracován v rámci projektu EU peníze školám Registrační číslo projektu: CZ.1.07/1.5.00/34.0996 Výukový materiál zpracován v rámci projektu EU peníze školám Registrační číslo projektu: CZ.1.07/1.5.00/34.0996 Šablona: III/2 č. materiálu: VY_32_INOVACE_CHE_413 Jméno autora: Mgr. Alena Krejčíková Třída/ročník:


Bílkoviny. Charakteristika a význam Aminokyseliny Peptidy Struktura bílkovin Významné bílkoviny

Bílkoviny. Charakteristika a význam Aminokyseliny Peptidy Struktura bílkovin Významné bílkoviny Bílkoviny harakteristika a význam Aminokyseliny Peptidy Struktura bílkovin Významné bílkoviny 1) harakteristika a význam Makromolekulární látky složené z velkého počtu aminokyselinových zbytků V tkáních


Gymnázium Vysoké Mýto nám. Vaňorného 163, 566 01 Vysoké Mýto

Gymnázium Vysoké Mýto nám. Vaňorného 163, 566 01 Vysoké Mýto Gymnázium Vysoké Mýto nám. Vaňorného 163, 566 01 Vysoké Mýto SUBSTITUČNÍ DERIVÁTY KARBOXYLOVÝCH O KYSELIN R C O X karboxylových kyselin - substituce na vedlejším uhlovodíkovém řetězci aminokyseliny - hydroxykyseliny


V organismu se bílkoviny nedají nahradit žádnými jinými sloučeninami, jen jako zdroj energie je mohou nahradit sacharidy a lipidy.

V organismu se bílkoviny nedají nahradit žádnými jinými sloučeninami, jen jako zdroj energie je mohou nahradit sacharidy a lipidy. BÍLKOVINY Bílkoviny jsou biomakromolekulární látky, které se skládají z velkého počtu aminokyselinových zbytků. Vytvářejí látkový základ života všech organismů. V tkáních vyšších organismů a člověka je


Využití strojového učení k identifikaci protein-ligand aktivních míst

Využití strojového učení k identifikaci protein-ligand aktivních míst Využití strojového učení k identifikaci protein-ligand aktivních míst David Hoksza, Radoslav Krivák SIRET Research Group Katedra softwarového inženýrství, Matematicko-fyzikální fakulta Karlova Univerzita


Aminokyseliny příručka pro učitele. Obecné informace: Téma otevírá kapitolu Bílkoviny, která svým rozsahem překračuje rámec jedné vyučovací hodiny.

Aminokyseliny příručka pro učitele. Obecné informace: Téma otevírá kapitolu Bílkoviny, která svým rozsahem překračuje rámec jedné vyučovací hodiny. Obecné informace: Aminokyseliny příručka pro učitele Téma otevírá kapitolu Bílkoviny, která svým rozsahem překračuje rámec jedné vyučovací hodiny. Navazující učivo Před probráním tématu Aminokyseliny probereme


Aminokyseliny, proteiny, enzymologie

Aminokyseliny, proteiny, enzymologie Aminokyseliny, proteiny, enzymologie Aminokyseliny Co to je? Organické látky karboxylové kyseliny, které mají na sousedním uhlíku navázanou aminoskupinu Jak to vypadá? K čemu je to dobré? AK jsou stavební


Lodish et al, Molecular Cell Biology, 4-6 vydání Alberts et al, Molecular Biology of the Cell, 4 vydání

Lodish et al, Molecular Cell Biology, 4-6 vydání Alberts et al, Molecular Biology of the Cell, 4 vydání Lodish et al, Molecular Cell Biology, 4-6 vydání Alberts et al, Molecular Biology of the Cell, 4 vydání CHEMICKÉ SLOŽENÍ BUŇKY BUŇKA: 99 % C, H, N,


ÚVOD DO BIOCHEMIE. Dělení : 1)Popisná = složení org., struktura a vlastnosti látek 2)Dynamická = energetické změny

ÚVOD DO BIOCHEMIE. Dělení : 1)Popisná = složení org., struktura a vlastnosti látek 2)Dynamická = energetické změny BIOCHEMIE 1 ÚVOD DO BIOCHEMIE BCH zabývá se chemickými procesy v organismu a chemickým složením živých organismů Biologie: bios = život + logos = nauka Biochemie: bios = život + chemie Dělení : Chemie


Struktura proteinů a funkce enzymů

Struktura proteinů a funkce enzymů Struktura proteinů a funkce enzymů RNDr. Tomáš Obšil, PhD. Katedra fyzikální a makromolekulární chemie Přírodovědecká fakulta UK v Praze HTobsil@natur.cuni.czTH 1. Struktura proteinů Proteiny se skládají


CHEMIE. Pracovní list č. 10 - žákovská verze Téma: Bílkoviny. Mgr. Lenka Horutová

CHEMIE. Pracovní list č. 10 - žákovská verze Téma: Bílkoviny. Mgr. Lenka Horutová CHEMIE Pracovní list č. 10 - žákovská verze Téma: Bílkoviny Lektor: Mgr. Lenka Horutová Projekt: Student a konkurenceschopnost Reg. číslo: CZ.1.07/1.1.07/03.0075 Teorie: Název proteiny


Co se o sobě dovídáme z naší genetické informace

Co se o sobě dovídáme z naší genetické informace Genomika a bioinformatika Co se o sobě dovídáme z naší genetické informace Jan Pačes, Mgr, Ph.D Ústav molekulární genetiky AVČR, CZECH FOBIA (Free and Open Bioinformatics Association)


Výukový materiál zpracován v rámci projektu EU peníze školám

Výukový materiál zpracován v rámci projektu EU peníze školám Výukový materiál zpracován v rámci projektu EU peníze školám egistrační číslo projektu: Z.1.07/1.4.00/21.3665 Šablona: III/2 č. materiálu: VY_32_INVAE_164 Jméno autora: Ing. Kateřina Lisníková Třída/ročník:


PEPTIDY, BÍLKOVINY. Reg. č. projektu CZ.1.07/1.1.00/14.0143

PEPTIDY, BÍLKOVINY. Reg. č. projektu CZ.1.07/1.1.00/14.0143 PEPTIDY, BÍLKOVINY Definice: Bílkoviny (proteiny) jsou makromolekulární látky, které vznikají spojením sto a více molekul různých aminokyselin peptidickou vazbou. Obsahují atomy uhlíku (50 až 55%), vodíku


TEST + ŘEŠENÍ. PÍSEMNÁ ČÁST PŘIJÍMACÍ ZKOUŠKY Z CHEMIE bakalářský studijní obor Bioorganická chemie 2010

TEST + ŘEŠENÍ. PÍSEMNÁ ČÁST PŘIJÍMACÍ ZKOUŠKY Z CHEMIE bakalářský studijní obor Bioorganická chemie 2010 30 otázek maximum: 60 bodů TEST + ŘEŠEÍ PÍSEMÁ ČÁST PŘIJÍMACÍ ZKUŠKY Z CEMIE bakalářský studijní obor Bioorganická chemie 2010 1. apište názvy anorganických sloučenin: (4 body) 4 BaCr 4 kyselina peroxodusičná


Chemická vazba Něco málo opakování Něco málo opakování Co je to atom? Něco málo opakování Co je to atom? Atom je nejmenší částice hmoty, chemicky dále nedělitelná. Skládá se z atomového jádra obsahujícího


Organická chemie 3.ročník studijního oboru - kosmetické služby.

Organická chemie 3.ročník studijního oboru - kosmetické služby. Organická chemie 3.ročník studijního oboru - kosmetické služby. T-7 Funkční a substituční deriváty karboxylových kyselin Zpracováno v rámci projektu Zlepšení podmínek ke vzdělávání Registrační číslo projektu:


Princip ionexové chromatografie a analýza aminokyselin

Princip ionexové chromatografie a analýza aminokyselin Princip ionexové chromatografie a analýza aminokyselin Teoretická část: vysvětlení principu ionexové (iontové) chromatografie, příprava vzorku pro analýzu aminokyselin (kyselá a alkalická hydrolýza), derivatizace


Složení a struktura základních biomolekul (nk,proteiny,sacharidy)

Složení a struktura základních biomolekul (nk,proteiny,sacharidy) Složení a struktura základních biomolekul (nk,proteiny,sacharidy) 1 Proteiny Aminokyseliny Obrázek 1: Aminokyseliny Všechny bílkoviny, co jich na světě je, se skládají z 20 aminokyselin (AA) na Obrázku


Počítačová chemie. výpočetně náročné simulace chemických a biomolekulárních systémů. Zora Střelcová

Počítačová chemie. výpočetně náročné simulace chemických a biomolekulárních systémů. Zora Střelcová Počítačová chemie výpočetně náročné simulace chemických a biomolekulárních systémů Zora Střelcová Národní centrum pro výzkum biomolekul, Masarykova univerzita, Kotlářská 2, 611 37 Brno, Česká Republika


Bílkoviny příručka pro učitele. Obecné informace:

Bílkoviny příručka pro učitele. Obecné informace: Obecné informace: Bílkoviny příručka pro učitele Téma Bílkoviny přesáhne rámec jedné vyučovací hodiny. Vyučující rozdělí téma na 2 vyučovací hodiny, zadá klasifikaci bílkovin jako samostatnou práci popř.


TUKY. Autor: Mgr. Stanislava Bubíková. Datum (období) tvorby: 15. 3. 2013. Ročník: devátý

TUKY. Autor: Mgr. Stanislava Bubíková. Datum (období) tvorby: 15. 3. 2013. Ročník: devátý TUKY Autor: Mgr. Stanislava Bubíková Datum (období) tvorby: 15. 3. 2013 Ročník: devátý Vzdělávací oblast: Člověk a příroda / Chemie / Organické sloučeniny 1 Anotace: Žáci se seznámí s lipidy. V rámci tohoto





Molekulární základ dědičnosti

Molekulární základ dědičnosti Molekulární základ dědičnosti Dědičná informace je zakódována v deoxyribonukleové kyselině, která je uložena v jádře buňky v chromozómech. Zlomovým objevem pro další rozvoj molekulární genetiky bylo odhalení


Sylabus pro předmět Biochemie pro jakost

Sylabus pro předmět Biochemie pro jakost Sylabus pro předmět Biochemie pro jakost Kód předmětu: BCHJ Název v jazyce výuky: Biochemie pro Jakost Název česky: Biochemie pro Jakost Název anglicky: Biochemistry Počet přidělených ECTS kreditů: 6 Forma


Deriváty karboxylových kyselin

Deriváty karboxylových kyselin Deriváty karboxylových kyselin Tento výukový materiál vznikl za přispění Evropské unie, státního rozpočtu ČR a Středočeského kraje Duben 2011 Mgr. Alena Jirčáková Substituční deriváty karboxylových kyselin:


Teorie hybridizace. Vysvětluje vznik energeticky rovnocenných kovalentních vazeb a umožňuje předpovědět prostorový tvar molekul.

Teorie hybridizace. Vysvětluje vznik energeticky rovnocenných kovalentních vazeb a umožňuje předpovědět prostorový tvar molekul. Chemická vazba co je chemická vazba charakteristiky chemické vazby jak vzniká vazba znázornění chemické vazby kovalentní a koordinační vazba vazba σ a π jednoduchá, dvojná a trojná vazba polarita vazby


Inovace profesní přípravy budoucích učitelů chemie

Inovace profesní přípravy budoucích učitelů chemie Inovace profesní přípravy budoucích učitelů chemie I n v e s t i c e d o r o z v o j e v z d ě l á v á n í CZ.1.07/2.2.00/15.0324 Tento projekt je spolufinancován Evropským sociálním fondem a státním rozpočtem


DUM č. 10 v sadě. 37. Bi-2 Cytologie, molekulární biologie a genetika

DUM č. 10 v sadě. 37. Bi-2 Cytologie, molekulární biologie a genetika projekt GML Brno Docens DUM č. 10 v sadě 37. Bi-2 Cytologie, molekulární biologie a genetika Autor: Martin Krejčí Datum: 26.06.2014 Ročník: 6AF, 6BF Anotace DUMu: Procesy následující bezprostředně po transkripci.


Aminokyseliny. Aminokyseliny. Peptidy & proteiny Enzymy Lipidy COOH H 2 N. Aminokyseliny. Aminokyseliny. Postranní řetězec

Aminokyseliny. Aminokyseliny. Peptidy & proteiny Enzymy Lipidy COOH H 2 N. Aminokyseliny. Aminokyseliny. Postranní řetězec optická aktivita Peptidy & proteiny Enzymy Lipidy α-uhlík je asymetrický pouze L-aminokyseliny 2 α R rozdělení dle polarity podle počtu karboxylových skupin podle počtu bazických skupin podle polarity


Biochemie Ch52 volitelný předmět pro 4. ročník

Biochemie Ch52 volitelný předmět pro 4. ročník Biochemie Ch52 volitelný předmět pro 4. ročník Charakteristika vyučovacího předmětu Vyučovací předmět vychází ze vzdělávací oblasti Člověk a příroda, vzdělávacího oboru Chemie. Mezipředmětové přesahy a


Úvodem Dříve les než stromy 3 Operace s maticemi

Úvodem Dříve les než stromy 3 Operace s maticemi Obsah 1 Úvodem 13 2 Dříve les než stromy 17 2.1 Nejednoznačnost terminologie 17 2.2 Volba metody analýzy dat 23 2.3 Přehled vybraných vícerozměrných metod 25 2.3.1 Metoda hlavních komponent 26 2.3.2 Faktorová


Interakce proteinu p53 s genomovou DNA v kontextu chromatinu glioblastoma buněk

Interakce proteinu p53 s genomovou DNA v kontextu chromatinu glioblastoma buněk MASARYKOVA UNIVERZITA V BRNĚ Přírodovědecká fakulta Ústav experimentální biologie Oddělení genetiky a molekulární biologie Interakce proteinu p53 s genomovou DNA v kontextu chromatinu glioblastoma buněk


Molekuly 1 21.09.13. Molekula definice IUPAC. Proč existují molekuly? Molekuly. Kosselův model. Představy o molekulách. mezi atomy vzniká vazba

Molekuly 1 21.09.13. Molekula definice IUPAC. Proč existují molekuly? Molekuly. Kosselův model. Představy o molekulách. mezi atomy vzniká vazba C e l k o v á e n e r g i e 1.09.13 Molekuly 1 Molekula definice IUPAC l elektricky neutrální entita sestávající z více nežli jednoho atomu. Přesně, molekula, v níž je počet atomů větší nežli jedna, musí


Absorpční spektroskopie při biologické analýze molekul

Absorpční spektroskopie při biologické analýze molekul Absorpční spektroskopie při biologické analýze molekul Pokročilé biofyzikální metody v experimentální biologii Ctirad Hofr 8.11.2007 7 1 UV spektroskopie DNA a proteinů Všechny atomy absorbují v UV oblasti





V. letní škola metod molekulární biologie nukleových kyselin a genomiky 16. - 20. 6. 2014. Ústav morfologie, fyziologie a genetiky zvířat AF MENDELU

V. letní škola metod molekulární biologie nukleových kyselin a genomiky 16. - 20. 6. 2014. Ústav morfologie, fyziologie a genetiky zvířat AF MENDELU V. letní škola metod molekulární biologie nukleových kyselin a genomiky 16. - 20. 6. 2014 Ústav morfologie, fyziologie a genetiky zvířat AF MENDELU Zemědělská 1, Budova A, 4. patro (učebny dle programu)


ě č č Č Č Í ěř ý é ý ě é á á ř á Č á á ě é Č á á šť ř ž Č á á Š ě á á ě č Č Č ž é á ě é á ýš č á á ů é ýš č é á ě é á á ě é á é á š č é ř ú ě á ů á á á é ě č ě á ě ě š á á ř é á é č ý áá é ě š ř ů á ř


Tabulace učebního plánu. Obecná chemie. Vzdělávací obsah pro vyučovací předmět : Ročník: 1.ročník a kvinta

Tabulace učebního plánu. Obecná chemie. Vzdělávací obsah pro vyučovací předmět : Ročník: 1.ročník a kvinta Tabulace učebního plánu Vzdělávací obsah pro vyučovací předmět : CHEMIE Ročník: 1.ročník a kvinta Obecná Bezpečnost práce Názvosloví anorganických sloučenin Zná pravidla bezpečnosti práce a dodržuje je.


Ž ř ú ř ř ř Šř ř ř ú ň Ž Ž ů ú ů šř ů ú ů ř ř Ž ř ř Č ř ř ř Č šř ů Ú Ř Ú ů ř ú ů š šř ř š ú š ř ř š š ř ř ú Ž Š ů š ř š ř Ž ů ú ů Ú Ž ř ú ř Ú ú šř ů š ů Ž Ž ř ů Ž Ú ů Ž ř ř ř ť ů ň ř ů Á ř ň ř ů Ř ú ó


Mutace s dobrou prognózou, mutace se špatnou prognózou omezené možnosti biologické léčby pro onkologické pacienty

Mutace s dobrou prognózou, mutace se špatnou prognózou omezené možnosti biologické léčby pro onkologické pacienty Mutace s dobrou prognózou, mutace se špatnou prognózou omezené možnosti biologické léčby pro onkologické pacienty J.Berkovcová, M.Dziechciarková, M.Staňková, A.Janošťáková, D.Dvořáková, M.Hajdúch Laboratoř


Přírodní látky pracovní list

Přírodní látky pracovní list Přírodní látky pracovní list VY_52_INOVACE_199 Vzdělávací oblast: Člověk a příroda Vzdělávací obor: Chemie Ročník: 9 Přírodní látky pracovní list 1)Doplňte křížovku Tajenkou je název skupiny přírodních


Příloha 4. Porovnání prototypů jednotlivých souborů s podpisem zdroje

Příloha 4. Porovnání prototypů jednotlivých souborů s podpisem zdroje Porovnání prototypů jednotlivých souborů s podpisem zdroje Obsah 1. ÚVOD... 4 2. SROVNÁNÍ PROTOTYPŮ JEDNOTLIVÝCH SOUBORŮ S PODPISEM ZDROJE... 4 2.1 POLYCYKLICKÉ AROMATICKÉ UHLOVODÍKY... 4 2.2 TĚŽKÉ KOVY...


OPVK CZ.1.07/2.2.00/28.0184

OPVK CZ.1.07/2.2.00/28.0184 OPVK CZ.1.07/2.2.00/28.0184 Drug-design - racionální návrh léčiv KFC/DD 03 molekulární cíl RNDr. Karel Berka, Ph.D. ZS 2012/2013 Motto Bez cíle se ani Robin Hood netrefí. Nejmenovaný autor tohoto kurzu


Dyson s Coulomb gas on a circle and intermediate eigenvalue statistics

Dyson s Coulomb gas on a circle and intermediate eigenvalue statistics Dyson s Coulomb gas on a circle and intermediate eigenvalue statistics Rainer Scharf, Félix M. Izrailev, 1990 rešerše: Pavla Cimrová, 28. 2. 2012 1 Náhodné matice Náhodné matice v současnosti nacházejí


Degenerace genetického kódu

Degenerace genetického kódu AJ: degeneracy x degeneration CJ: degenerace x degenerace Degenerace genetického kódu Genetický kód je degenerovaný, resp. redundantní, což znamená, že dva či více kodonů může kódovat jednu a tutéž aminokyselinu.


Sešit pro laboratorní práci z chemie

Sešit pro laboratorní práci z chemie Sešit pro laboratorní práci z chemie téma: Reakce aminokyselin a bílkovin autor: MVDr. Alexandra Gajová vytvořeno při realizaci projektu: Inovace školního vzdělávacího programu biologie a chemie registrační



PREZENTACE ANTIGENU A REGULACE NA ÚROVNI Th (A DALŠÍCH) LYMFOCYTŮ PREZENTACE ANTIGENU PREZENTACE ANTIGENU A REGULACE NA ÚROVNI Th (A DALŠÍCH) LYMFOCYTŮ PREZENTACE ANTIGENU Podstata prezentace antigenu (MHC restrikce) byla objevena v roce 1974 V současnosti je zřejmé, že to je jeden z klíčových


Biochemie. ochrana životního prostředí analytická chemie chemická technologie Forma vzdělávání: Platnost: od 1. 9. 2009 do 31. 8.

Biochemie. ochrana životního prostředí analytická chemie chemická technologie Forma vzdělávání: Platnost: od 1. 9. 2009 do 31. 8. Studijní obor: Aplikovaná chemie Učební osnova předmětu Biochemie Zaměření: ochrana životního prostředí analytická chemie chemická technologie Forma vzdělávání: denní Celkový počet vyučovacích hodin za


Chemie. 5. K uvedeným vzorcům (1 5) přiřaďte tvar struktury (A D) jejich molekuly. 1) CO 2 2) SO 2 3) SO 3 4) NH 3 5) BF 3.

Chemie. 5. K uvedeným vzorcům (1 5) přiřaďte tvar struktury (A D) jejich molekuly. 1) CO 2 2) SO 2 3) SO 3 4) NH 3 5) BF 3. Chemie 1. Analýzou vzorku bylo zjištěno, že vzorek o hmotnosti 25 g obsahuje 15,385 g mědi, 3,845 g síry a zbytek připadá na kyslík. Který empirický vzorec uvedeným výsledkům analýzy odpovídá? A r (Cu)


Š ť ř š ř éú Ú ýú á Ú čá é á č éč ě ě š ř ů Ú á č ě ě š ř ů Ú á ř ě ř éř ů á ř č Ú ř ý č ář ý á ý é ě ý Ú ř š ř ý ř Ú á á Č Č Č č Ú á á Ú á á éč á ě ý áč ý á ě ň ř á á á ě á á á Ú č ř č ý á á ýý á ě ěř



I N V E S T I C E D O R O Z V O J E V Z D Ě L Á V Á N Í ORGANIKÁ EMIE = chemie sloučenin látek obsahujících vazby Organické látky = všechny uhlíkaté sloučeniny kromě..., metal... and metal... Zdroje organických sloučenin = živé organismy nebo jejich fosílie:


Co nás učí nádory? Prof. RNDr. Jana Šmardová, CSc. Ústav patologie FN Brno Přírodovědecká a Lékařská fakulta MU Brno

Co nás učí nádory? Prof. RNDr. Jana Šmardová, CSc. Ústav patologie FN Brno Přírodovědecká a Lékařská fakulta MU Brno Co nás učí nádory? Prof. RNDr. Jana Šmardová, CSc. Ústav patologie FN Brno Přírodovědecká a Lékařská fakulta MU Brno Brno, 17.5.2011 Izidor (Easy Door) Osnova přednášky 1. Proč nás rakovina tolik zajímá?


Thursday, February 27, 14

Thursday, February 27, 14 DATABÁZE A VYHLEDÁVÁNÍ SEKVENCÍ MOLEKULÁRNÍ TAXONOMIE 2014 MARIAN NOVOTNÝ PŘEDNÁŠEJÍCÍ Mgr. Marian NOVOTNÝ, PhD. vystudoval odbornou biologii na PřF UK, diplomka v laboratoři doc. Folka doktorát na Uppsalské


TEST (Aminokyseliny) 9. Kolik je esenciálních aminokyselin a kdo je neumí syntetizovat?

TEST (Aminokyseliny) 9. Kolik je esenciálních aminokyselin a kdo je neumí syntetizovat? TEST (Aminokyseliny) A 1. Definuj deriváty uhlovodíků 2. Napiš obecný vzorec karboxylové kyseliny 3. Napiš vzorec ß - aminakyseliny 5. Doplň: větu: Oligopeptid je... 6. Doplňte větu: Silon vznikl... 7.


Úvod do studia organické chemie

Úvod do studia organické chemie Úvod do studia organické chemie 1828... Wöhler... uměle připravil močovinu Organická chemie - chemie sloučenin uhlíku a vodíku, případně dalších prvků (O, N, X, P, S) Příčiny stability uhlíkových řetězců:


Využití synchrotronového záření pro diagnostiku a vývoj nových léčiv

Využití synchrotronového záření pro diagnostiku a vývoj nových léčiv Využití synchrotronového záření pro diagnostiku a vývoj nových léčiv J.Hašek, ÚMCH AV ČR Zisky farmaceutických společností a společností využívajících biotechnologie činící mnoha miliard dolarů ročně jsou



OBOROVÁ RADA BIOCHEMIE A PATOBIOCHEMIE OBOROVÁ RADA BIOCHEMIE A PATOBIOCHEMIE Předseda: Stanislav Štípek, prof., MUDr., DrSc. Ústav lékařske biochemie a laboratorní disgnostiky 1. LF UK Kateřinská 32, 121 08 Praha 2 tel.: 224 964 283 fax: 224


Molekulární diagnostika infekční bronchitidy v České republice a na Slovensku. Richard J W Currie

Molekulární diagnostika infekční bronchitidy v České republice a na Slovensku. Richard J W Currie Molekulární diagnostika infekční bronchitidy v České republice a na Slovensku Richard J W Currie Virus infekční bronchitidy RNA (nukleová kyselina) uvnitř Proteiny (spike proteiny S1 a S2) na vnější straně


Výpočet stechiometrického a sumárního vzorce

Výpočet stechiometrického a sumárního vzorce Výpočet stechiometrického a sumárního vzorce Stechiometrický (empirický) vzorec vyjadřuje základní složení sloučeniny udává, z kterých prvků se sloučenina skládá a v jakém poměru jsou atomy těchto prvků


Didaktické testy z biochemie 1

Didaktické testy z biochemie 1 Didaktické testy z biochemie 1 Trávení Milada Roštejnská elena Klímová Trávení br. 1. Trávicí soustava Rubrika A Z pěti možných odpovědí (alternativ) vyberte tu nejsprávnější. A B D E 1 Mezi monosacharidy


RNA interference (RNAi)

RNA interference (RNAi) Liběchov, 29. 11. 2013 RNA interference (RNAi) post-transkripční umlčení genové exprese přirozený mechanismus regulace genové exprese a genomové stability obranný antivirový mechanismus konzervovaný mechanismus


Jsme tak odlišní. Co nás spojuje..? Nukleové kyseliny

Jsme tak odlišní. Co nás spojuje..? Nukleové kyseliny Jsme tak odlišní Co nás spojuje..? ukleové kyseliny 1 UKLEVÉ KYSELIY = K anj = A ositelky genetických informací Základní význam pro všechny organismy V buňkách a virech Identifikace v buněčném jádře (nucleos)


Doprovodný materiál k práci s přípravným textem Biologické olympiády 2014/2015 pro soutěžící a organizátory kategorie B

Doprovodný materiál k práci s přípravným textem Biologické olympiády 2014/2015 pro soutěžící a organizátory kategorie B Doprovodný materiál k práci s přípravným textem Biologické olympiády 2014/2015 pro soutěžící a organizátory kategorie B Níže uvedené komentáře by měly pomoci soutěžícím z kategorie B ke snazší orientaci


á ě č č ú řá ě řá ř č Ú č á ě ú řá ě řá á úř ř ř š á č ú á řá á ě ě š ř ů á é ěř š á á ě á řá ě ě š ř ů á á řá é ě ú úč ůú ř ě ů č ř ř čá ř Ž ř š é ř šť é ě é ř ř ů č ř ř čá ř Ž ř ď é ř š é ě é ř Ť č á


Eva Benešová. Dýchací řetězec

Eva Benešová. Dýchací řetězec Eva Benešová Dýchací řetězec Dýchací řetězec Během oxidace látek vstupujících do různých metabolických cyklů (glykolýza, CC, beta-oxidace MK) vznikají NADH a FADH 2, které následně vstupují do DŘ. V DŘ


Úvod do mobilní robotiky NAIL028

Úvod do mobilní robotiky NAIL028 md at 11. listopadu 2008 1 2 PID Sledování cesty Modely kolových vozidel (1/5) Diferenční řízení tank b Encoder Motor Centerpoint Motor Encoder Modely kolových



MOLEKULÁRNÍ ZÁKLADY DĚDIČNOSTI Maturitní téma č. 33 MOLEKULÁRNÍ ZÁKLADY DĚDIČNOSTI NUKLEOVÉ KYSELINY - jsou to makromolekuly tvořené řetězci vzájemně spojených nukleotidů. Molekula nukleotidu sestává z : - pětiuhlíkatého monosacharidu


Stanovení forem, termínů a témat profilové části maturitní zkoušky oboru vzdělání 78-42-M/01 Technické lyceum STROJNICTVÍ

Stanovení forem, termínů a témat profilové části maturitní zkoušky oboru vzdělání 78-42-M/01 Technické lyceum STROJNICTVÍ Stanovení forem, termínů a témat profilové části maturitní zkoušky oboru vzdělání 78-42-M/01 Technické lyceum STROJNICTVÍ 1. Mechanické vlastnosti materiálů 2. Technologické vlastnosti materiálů 3. Zjišťování


Inovace studia molekulární a buněčné biologie reg. č. CZ.1.07/2.2.00/07.0354

Inovace studia molekulární a buněčné biologie reg. č. CZ.1.07/2.2.00/07.0354 I n v e s t i c e d o r o z v o j e v z d ě l á v á n í Inovace studia molekulární a buněčné biologie reg. č. CZ.1.07/2.2.00/07.0354 Tento projekt je spolufinancován Evropským sociálním fondem a státním


Konsultační hodina. základy biochemie pro 1. ročník. Přírodní látky Úvod do metabolismu Glykolysa Krebsův cyklus Dýchací řetězec Fotosynthesa

Konsultační hodina. základy biochemie pro 1. ročník. Přírodní látky Úvod do metabolismu Glykolysa Krebsův cyklus Dýchací řetězec Fotosynthesa Konsultační hodina základy biochemie pro 1. ročník Přírodní látky Úvod do metabolismu Glykolysa Krebsův cyklus Dýchací řetězec Fotosynthesa Přírodní látky 1 Co to je? Cukry (Sacharidy) Organické látky,


VY_32_INOVACE_003. VÝUKOVÝ MATERIÁL zpracovaný v rámci projektu EU peníze školám

VY_32_INOVACE_003. VÝUKOVÝ MATERIÁL zpracovaný v rámci projektu EU peníze školám VY_32_INOVACE_003 VÝUKOVÝ MATERIÁL zpracovaný v rámci projektu EU peníze školám Registrační číslo projektu: CZ. 1.07. /1. 5. 00 / 34. 0696 Šablona: III/2 Název: Základní znaky života Vyučovací předmět:


materiál č. šablony/č. sady/č. materiálu: Autor:

materiál č. šablony/č. sady/č. materiálu: Autor: Masarykova základní škola Klatovy, tř. Národních mučedníků 185, 339 01 Klatovy; 376312154, fax 376326089 E-mail:; internet: Kód přílohy vzdělávací VY_32_INOVACE_CH8SA_01_03_14


Názvosloví anorganických sloučenin

Názvosloví anorganických sloučenin Chemické názvosloví Chemické prvky jsou látky složené z atomů o stejném protonovém čísle (počet protonů v jádře atomu. Každému prvku přísluší určitý mezinárodní název a od něho odvozený symbol (značka).


Modely vyhledávání informací 4 podle technologie. 1) Booleovský model. George Boole 1815 1864. Aplikace booleovské logiky

Modely vyhledávání informací 4 podle technologie. 1) Booleovský model. George Boole 1815 1864. Aplikace booleovské logiky Modely vyhledávání informací 4 podle technologie 1) Booleovský model 1) booleovský 2) vektorový 3) strukturní 4) pravděpodobnostní a další 1 dokumenty a dotazy jsou reprezentovány množinou indexových termů


Číslo materiálu Předmět ročník Téma hodiny Ověřený materiál Program

Číslo materiálu Předmět ročník Téma hodiny Ověřený materiál Program Číslo materiálu Předmět ročník Téma hodiny Ověřený materiál Program 1 VY_32_INOVACE_01_13 fyzika 6. Elektrické vlastnosti těles Výklad učiva PowerPoint 6 4 2 VY_32_INOVACE_01_14 fyzika 6. Atom Výklad učiva


Úvod do laserové techniky KFE FJFI ČVUT Praha Michal Němec, 2014. Plynové lasery. Plynové lasery většinou pracují v kontinuálním režimu.

Úvod do laserové techniky KFE FJFI ČVUT Praha Michal Němec, 2014. Plynové lasery. Plynové lasery většinou pracují v kontinuálním režimu. Aktivní prostředí v plynné fázi. Plynové lasery Inverze populace hladin je vytvářena mezi energetickými hladinami některé ze složek plynu - atomy, ionty nebo molekuly atomární, iontové, molekulární lasery.


N 2 + 8[H] + 16 ATP 2NH 3 + H 2 + 16ADP + 16P i

N 2 + 8[H] + 16 ATP 2NH 3 + H 2 + 16ADP + 16P i 1. Fixace N 2 v širším kontextu Biologická fixace vzdušného dusíku představuje z hlediska globální bilance N 2 důležitý proces jímž je plynný dusík asimilován do živé biomasy. Z povahy vazby mezi atomy


Projekt VODA ve výuce chemie na Gymnáziu Komenského v Havířově ve školním roce 2011/2012

Projekt VODA ve výuce chemie na Gymnáziu Komenského v Havířově ve školním roce 2011/2012 Projekt VODA ve výuce chemie na Gymnáziu Komenského v Havířově ve školním roce 2011/2012 Třída: sekunda osmiletého gymnázia Počet žáků: 28 Počet skupin zpracovávajících projekt: 5 Časové rozvržení projektu


EU peníze středním školám digitální učební materiál

EU peníze středním školám digitální učební materiál EU peníze středním školám digitální učební materiál Číslo projektu: Číslo a název šablony klíčové aktivity: Tematická oblast, název DUMu: Autor: Z.1.07/1.5.00/34.0515 III/2 Inovace a zkvalitnění výuky


Molekulární diagnostika

Molekulární diagnostika Molekulární diagnostika Odry 11. 11. 2010 Michal Pohludka, Ph.D. Buňka základní jednotka živé hmoty Všechny v současnosti známé buňky se vyvinuly ze společného předka, tedy buňky, která žila asi před 3,5-3,8



ZÍSKÁVÁNÍ ZNALOSTÍ Z DATABÁZÍ metodický list č. 1 Dobývání znalostí z databází Cílem tohoto tematického celku je vysvětlení základních pojmů z oblasti dobývání znalostí z databází i východisek dobývání znalostí z databází inspirovaných


Rizikové úseky silnic z pohledu dopravních nehod

Rizikové úseky silnic z pohledu dopravních nehod Rizikové úseky silnic z pohledu dopravních nehod Ing. Jan TESLA, Ing. Igor IVAN, Ph.D. INSTITUT GEOINFORMATIKY VYSOKÁ ŠKOLA BÁŇSKÁ TECHNICKÁ UNIVERZITA OSTRAVA Cíle projektu Zpracování dat o dopravních


Biomarkery - diagnostika a prognóza nádorových onemocnění

Biomarkery - diagnostika a prognóza nádorových onemocnění Biomarkery - diagnostika a prognóza nádorových onemocnění O. Topolčan,M.Pesta, J.Kinkorova, R. Fuchsová Fakultní nemocnice a Lékařská fakulta Plzeň CZ.1.07/2.3.00/20.0040 a IVMZČR Témata přednášky Přepdpoklady


Vícerozměrné metody. PSY117/454 Statistická analýza dat v psychologii Přednáška 12. Schematický úvod

Vícerozměrné metody. PSY117/454 Statistická analýza dat v psychologii Přednáška 12. Schematický úvod PSY117/454 Statistická analýza dat v psychologii Přednáška 12 Vícerozměrné metody Schematický úvod Co je na slově statistika tak divného, že jeho vyslovení tak často způsobuje napjaté ticho? William Kruskal


5. Příjem, asimilace a fyziologické dopady anorganického dusíku. 5. Příjem, asimilace a fyziologické dopady anorganického dusíku

5. Příjem, asimilace a fyziologické dopady anorganického dusíku. 5. Příjem, asimilace a fyziologické dopady anorganického dusíku 5. Příjem, asimilace a fyziologické dopady anorganického dusíku Zdroje dusíku dostupné v půdě: Amonné ionty + Dusičnany = největší zdroj dusíku v půdě Organický dusík (aminokyseliny, aminy, ureidy) zpracování


Genetika. Genetika. Nauka o dědid. dičnosti a proměnlivosti. molekulárn. rní buněk organismů populací

Genetika. Genetika. Nauka o dědid. dičnosti a proměnlivosti. molekulárn. rní buněk organismů populací Genetika Nauka o dědid dičnosti a proměnlivosti Genetika molekulárn rní buněk organismů populací Dědičnost na úrovni nukleových kyselin Předávání vloh z buňky na buňku Předávání vlastností mezi jednotlivci


Bioinformatika. hledání významu biologických dat. Marian Novotný. Friday, April 24, 15

Bioinformatika. hledání významu biologických dat. Marian Novotný. Friday, April 24, 15 Bioinformatika hledání významu biologických dat Marian Novotný Bioinformatika sběr biologických dat archivace biologických dat organizace biologických dat interpretace biologických dat 2 Biologové sbírají


Výuka genetiky na PřF OU K. MALACHOVÁ

Výuka genetiky na PřF OU K. MALACHOVÁ Výuka genetiky na PřF OU K. MALACHOVÁ KATEDRA BIOLOGIE A EKOLOGIE BAKALÁŘSKÉ STUDIJNÍ PROGRAMY Experimentální Systematická Aplikovaná (prezenční, kombinovaná) Jednooborová Dvouoborová KATEDRA BIOLOGIE


Proč studovat hvězdy? 9. 1 Úvod 11 1.1 Energetické úvahy 11 1.2 Zjednodušení použitá při konstrukci sférických modelů... 13 1.3 Model našeho Slunce 15

Proč studovat hvězdy? 9. 1 Úvod 11 1.1 Energetické úvahy 11 1.2 Zjednodušení použitá při konstrukci sférických modelů... 13 1.3 Model našeho Slunce 15 Proč studovat hvězdy? 9 1 Úvod 11 1.1 Energetické úvahy 11 1.2 Zjednodušení použitá při konstrukci sférických modelů.... 13 1.3 Model našeho Slunce 15 2 Záření a spektrum 21 2.1 Elektromagnetické záření


ZŠ ÚnO, Bratří Čapků 1332

ZŠ ÚnO, Bratří Čapků 1332 Úvodní obrazovka Menu (vlevo nahoře) Návrat na hlavní stránku Obsah Výsledky Poznámky Záložky edunet Konec Chemie 1 (pro 12-16 let) LangMaster Obsah (střední část) výběr tématu - dvojklikem v seznamu témat


Základní škola a mateřská škola Hutisko Solanec. žák uvede základní druhy uhlovodíků, jejich použití a zdroje. Chemie - 9. ročník

Základní škola a mateřská škola Hutisko Solanec. žák uvede základní druhy uhlovodíků, jejich použití a zdroje. Chemie - 9. ročník Základní škola a mateřská škola Hutisko Solanec Digitální učební materiál Anotace: Autor: Jazyk: Očekávaný výstup: Speciální vzdělávací potřeby: Klíčová slova: Druh učebního materiálu: Druh interaktivity:


Uhlík a síra CH_102_Uhlík a síra Autor: PhDr. Jana Langerová

Uhlík a síra CH_102_Uhlík a síra Autor: PhDr. Jana Langerová Registrační číslo projektu: CZ.1.07/1.1.38/02.0025 Název projektu: Modernizace výuky na ZŠ Slušovice, Fryšták, Kašava a Velehrad Tento projekt je spolufinancován z Evropského sociálního fondu a státního


DUM č. 3 v sadě. 37. Bi-2 Cytologie, molekulární biologie a genetika

DUM č. 3 v sadě. 37. Bi-2 Cytologie, molekulární biologie a genetika projekt GML Brno Docens DUM č. 3 v sadě 37. Bi-2 Cytologie, molekulární biologie a genetika Autor: Martin Krejčí Datum: 02.06.2014 Ročník: 6AF, 6BF Anotace DUMu: chromatin - stavba, organizace a struktura


10. Energie a její transformace

10. Energie a její transformace 10. Energie a její transformace Energie je nejdůležitější vlastností hmoty a záření. Je obsažena v každém kousku hmoty i ve světelném paprsku. Je ve vesmíru a všude kolem nás. S energií se setkáváme na


Bílkoviny, tuky prezentace

Bílkoviny, tuky prezentace Bílkoviny, tuky prezentace VY_52_Inovace_243 Vzdělávací oblast: Člověk a příroda Vzdělávací obor: Chemie Ročník: 8, 9 Projekt EU peníze školám Operačního programu Vzdělávání pro konkurenceschopnost Bílkoviny


Biochemie I. Aminokyseliny a peptidy

Biochemie I. Aminokyseliny a peptidy Biochemie I Aminokyseliny a peptidy Aminokyseliny a peptidy (vlastnosti, stanovení a reakce) AMINOKYSELINY Když se řekne AK ( -COOH, -NH 2 nebo -NH-) prostorový vztah aminoskupiny a karboxylové skupiny:


Výukový materiál zpracován v rámci projektu EU peníze školám Registrační číslo projektu: CZ.1.07/1.5.00/34.0996

Výukový materiál zpracován v rámci projektu EU peníze školám Registrační číslo projektu: CZ.1.07/1.5.00/34.0996 Výukový materiál zpracován v rámci projektu EU peníze školám Registrační číslo projektu: CZ.1.07/1.5.00/34.0996 Šablona: III/2 č. materiálu: VY_32_INOVACE_CHE_419 Jméno autora: Třída/ročník: Mgr. Alena


Projekt realizovaný na SPŠ Nové Město nad Metují

Projekt realizovaný na SPŠ Nové Město nad Metují Projekt realizovaný na SPŠ Nové Město nad Metují s finanční podporou v Operačním programu Vzdělávání pro konkurenceschopnost Královéhradeckého kraje Modul 02 Přírodovědné předměty Hana Gajdušková 1 Viry
