Představujeme Vám pohodlné a bezplatné nástroje pro publikování a sdílení informací.

Neomezené množství

Nahrávejte kolik chcete kdykoliv potřebujete! Neomezený počet nahrávaných souborů. Můžete publikovat libovolný počet dokumentů v elektronické podobě ve formátu PDF, Microsoft Word a PowerPoint.

HTML5, žádný Flash

Všechny nahrané soubory na těchto stránkách jsou automaticky přizpůsobeny pro čtení na iPad, iPhone, Android a dalších platformách.

Zobrazit v okně prohlížeče

Možnost prohlížet dokumenty bez stahování – přímo v okně prohlížeče. Je to opravdu pohodlně!

Jaké úkoly mohou být řešeny pomocí našich stránek?

Na našich stránkách si můžete snadno najít knihy, které vám pomohou připravit se na zkoušku, hotové referáty, studentské práce a příručky z různých disciplín. Vzdělávací knihovna stránek má tisíce učebnic, článků a knih z různých disciplín.

Publikujte katalogy s výrobky na našich webových stránkách k dispozici pro širší publikum. Inzerujte svou firmu rozmístěním letáků, brožur a prezentačních materiálů. Najděte zajímavé nápady a řešení pro obchod, které sdílejí naši uživatelé.

Koupili jste si pračku, ale není tam žádný manuál? Využijte naše webové stránky pro hledání návodu. Máte nejnovější model? Pomozte ostatním – doplňte databázi instrukcí, která ještě chybí.

Zveřejňete výsledky Vašeho výzkumu nejen pro své kolegy, ale i pro širší publikum. Publikujte a diskutujte o svých článcích. Zůstaňte v obraze s nejnovějším vědeckým vývojem prostřednictvím našich webových stránek. Najděte odborné materiály na téma, které Vás zajímá, a podělte se o ně s kolegy.

Povězte o svých dílech lidem, publikujte práci na našich webových stránkách. Sbírka svátečních scénářů, poezie, sbírky povídek a další díly méně známých a nezávislých autorů.

Populární dokumenty

Fakulta elektrotechnick. P 0 0evodn k pro p 0 0ipojen kotl 0 1 s 0 0 zen m OpenTherm k syst m 0 1m Tecomat

Fakulta elektrotechnick. P 0 0evodn k pro p 0 0ipojen kotl 0 1 s 0 0 zen m OpenTherm k syst m 0 1m Tecomat 1 3 0 9esk vysok u 0 0en technick v Praze Fakulta elektrotechnick DIPLOMOV 0 9 PR 0 9CE P 0 0evodn k pro p 0 0ipojen kotl 0 1 s 0 0 zen m OpenTherm k syst m 0 1m Tecomat Praha, 2009 Autor: Jan Mal 0 5

Více

REPRODUKTOROVÁ SOUSTAVA S PŘÍMOU D/A KONVERZÍ

REPRODUKTOROVÁ SOUSTAVA S PŘÍMOU D/A KONVERZÍ VYSOKÉ UČENÍ TECHNICKÉ V BRNĚ BRNO UNIVERSITY OF TECHNOLOGY FAKULTA ELEKTROTECHNIKY A KOMUNIKAČNÍCH TECHNOLOGIÍ ÚSTAV TELEKOMUNIKACÍ FACULTY OF ELECTRICAL ENGINEERING AND COMMUNICATION DEPARTMENT OF TELECOMMUNICATIONS

Více

Život lidí s mentálním postižením. Lenka Chmelová

Život lidí s mentálním postižením. Lenka Chmelová Život lidí s mentálním postižením Lenka Chmelová Bakalářská práce 2010 ABSTRAKT Abstrakt česky Tato práce se zabývá ţivotem lidí s mentálním postiţením. Jejich tuţbami, zájmy, pracovním uplatněním,

Více

Práce s žáky s mentálním postižením

Práce s žáky s mentálním postižením EVROPSKÝ SOCIÁLNÍ FOND PRAHA & EU: INVESTUJEME DO VAŠÍ BUDOUCNOSTI Práce s žáky s mentálním postižením metodická příručka PhDr. Marcela Bernardová VYŠŠÍ ODBORNÁ ŠKOLA PEDAGOGICKÁ A SOCIÁLNÍ, STŘEDNÍ ODBORNÁ

Více

3.4 Průběh řízení o způsobilosti k právním úkonům a opatrovnictví...44 3.5 Práva lidí s mentálním postižením...46 3.5.1 Přehled mezinárodních úmluv a

3.4 Průběh řízení o způsobilosti k právním úkonům a opatrovnictví...44 3.5 Práva lidí s mentálním postižením...46 3.5.1 Přehled mezinárodních úmluv a OBSAH Úvod...6 1. Lidé s mentálním postižením...9 1.1 Mentální retardace...9 1.2 Péče o lidi s mentálním postižením...15 1.2.1 Historie péče o lidi s mentálním postižením...15 1.2.2 Současná situace...16

Více

SOUČASNÉ MORÁLNÍ HODNOTY ŽÁKŮ ODBORNÉHO UČILIŠTĚ

SOUČASNÉ MORÁLNÍ HODNOTY ŽÁKŮ ODBORNÉHO UČILIŠTĚ Masarykova univerzita v Brně Filozofická fakulta Ústav pedagogických věd SOUČASNÉ MORÁLNÍ HODNOTY ŽÁKŮ ODBORNÉHO UČILIŠTĚ Vypracoval: Mgr.Pavel Němec Vedoucí práce: Mgr.Vlastimil Čiháček, Ph.D. Brno, 2001

Více

UŽITÍ METOD HERNÍ TERAPIE U DĚTÍ S MENTÁLNÍM POSTIŽENÍM V MATEŘSKÉ ŠKOLE A U ŽÁKŮ ZÁKLADNÍ ŠKOLY PRAKTICKÉ. Diplomová práce

UŽITÍ METOD HERNÍ TERAPIE U DĚTÍ S MENTÁLNÍM POSTIŽENÍM V MATEŘSKÉ ŠKOLE A U ŽÁKŮ ZÁKLADNÍ ŠKOLY PRAKTICKÉ. Diplomová práce MASARYKOVA UNIVERZITA Pedagogická fakulta Katedra speciální pedagogiky UŽITÍ METOD HERNÍ TERAPIE U DĚTÍ S MENTÁLNÍM POSTIŽENÍM V MATEŘSKÉ ŠKOLE A U ŽÁKŮ ZÁKLADNÍ ŠKOLY PRAKTICKÉ Diplomová práce Brno 2007

Více

Důležité upozornění! Přečtěte si důkladně tyto informace, abyste mohli používat telefon správným a bezpečným způsobem: mobilní telefon EVOLVE Raptor

Důležité upozornění! Přečtěte si důkladně tyto informace, abyste mohli používat telefon správným a bezpečným způsobem: mobilní telefon EVOLVE Raptor CZ Důležité upozornění! Přečtěte si důkladně tyto informace, abyste mohli používat telefon správným a bezpečným způsobem: mobilní telefon EVOLVE Raptor 2.0 získal certifikaci IP54, tzn. že za přesně definovaných

Více

Váš telefon s Windows Phone 8X by HTC Uživatelská příručka

Váš telefon s Windows Phone 8X by HTC Uživatelská příručka Váš telefon s Windows Phone 8X by HTC Uživatelská příručka 2 Obsah Obsah Rozbalení Telefon 8 Karta SIM 9 Baterie 11 Zapínání a vypínání 12 Nastavení telefonu Zadání kódu PIN 13 Nastavení telefonu při prvním

Více

Determinace pohlaví a evoluce pohlavních chromosomů

Determinace pohlaví a evoluce pohlavních chromosomů Determinace pohlaví a evoluce pohlavních chromosomů Radka Reifová Katedra zoologie Prezentaci naleznete na: http://web.natur.cuni.cz/~radkas/ v záložce Courses Jak vznikají dvě pohlaví Mechanismy určení

Více

BIODIVERZITA. Co je biodiverzita a jak ji měřit Faktory, které biodiverzitu ovlivňují

BIODIVERZITA. Co je biodiverzita a jak ji měřit Faktory, které biodiverzitu ovlivňují BIODIVERZITA Co je biodiverzita a jak ji měřit Faktory, které biodiverzitu ovlivňují WWF Rozmanitost Co života je na to Zemi, biodiverzita? miliony druhů rostlin, živočichů a mikroorganismů, včetně genů,

Více

V případě předčasného splácení má klient právo na poměrné snížení celkových nákladů spotřebitelského úvěru. Výše náhrady nákladů se sjednává takto:

V případě předčasného splácení má klient právo na poměrné snížení celkových nákladů spotřebitelského úvěru. Výše náhrady nákladů se sjednává takto: (v) o provedení částečného předčasného splacení bude klient společností informován; součástí informace budou i podmínky pro další trvání a splácení úvěru vč. uvedení variabilního symbolu pro další platby;

Více

COMBI. Druhou i volitelnou třetí řadu sedadel lze složit, a tím získat podlahový prostor, takže naložení kohokoli i čehokoli je velmi snadné.

COMBI. Druhou i volitelnou třetí řadu sedadel lze složit, a tím získat podlahový prostor, takže naložení kohokoli i čehokoli je velmi snadné. NISSAN NV200 COMBI Feetová seva již při nákupu 1 vozu již od 403 500 Kč 403 500 5 et bez starostí! 5 et tovární záruka 1 + 5* servisní smouva POHODLNÝ A VARIABILNÍ Nissan NV200 Combi poskytuje více prostoru,

Více

pojištění vozidel Sazebník Auto Povinné ručení a havarijní pojištění

pojištění vozidel Sazebník Auto Povinné ručení a havarijní pojištění pojištění vozidel Sazebník Auto Povinné ručení a havarijní pojištění verze 0114 platnost od 1. 1. 2014 Předmět pojištění osobní a lehká užitková motorová vozidla s celkovou hmotností nepřevyšující 3,5

Více

Úvod 9. Přehled změn v zákoně o dani z přidané hodnoty s účinností od 1. 1. 2013 11 1 110 ČÁST PRVNÍ ZÁKLADNÍ USTANOVENÍ

Úvod 9. Přehled změn v zákoně o dani z přidané hodnoty s účinností od 1. 1. 2013 11 1 110 ČÁST PRVNÍ ZÁKLADNÍ USTANOVENÍ Úvod 9 Přehled změn v zákoně o dani z přidané hodnoty s účinností od 1. 1. 2013 11 1 110 ČÁST PRVNÍ ZÁKLADNÍ USTANOVENÍ 1 4 HLAVA I OBECNÁ USTANOVENÍ 1 Předmět úpravy 29 2 Předmět daně 29 2a Vynětí z předmětu

Více

Vývoj tyreopatií u žen s poruchou funkce štítné žlázy diagnostikovanou v graviditě

Vývoj tyreopatií u žen s poruchou funkce štítné žlázy diagnostikovanou v graviditě UNIVERZITA KARLOVA V PRAZE 1. LÉKAŘSKÁ FAKULTA Studijní program: Zdravotnická technika a informatika (MZTI, 5345T018) Studijní obor: Specializace ve zdravotnictví Vývoj tyreopatií u žen s poruchou funkce

Více

Poruchy funkce štítné žlázy

Poruchy funkce štítné žlázy Poruchy funkce štítné žlázy Examples of Genes Positively-regulated by T3. 1. Fatty acid synthetase 2. Growth hormone 3. Lysozyme silencer 4. Malic enzyme 5. Moloney leukemia virus enhancer 6. Myelin basic

Více

PŘÍBALOVÁ INFORMACE - INFORMACE PRO UŽIVATELE

PŘÍBALOVÁ INFORMACE - INFORMACE PRO UŽIVATELE Příloha č. 2 k rozhodnutí o prodloužení registrace sp. zn. sukls154273/2009, sukls154282/2009, sukls154285/2009, sukls154292/2009 a příloha k sp. zn. sukls99435/2009, sukls99436/2009, sukls99437/2009,

Více

Příloha č. 2 k rozhodnutí o prodloužení registrace sp.zn. sukls30927/2008 a příloha k sp.zn.: sukls84066/2011

Příloha č. 2 k rozhodnutí o prodloužení registrace sp.zn. sukls30927/2008 a příloha k sp.zn.: sukls84066/2011 Příloha č. 2 k rozhodnutí o prodloužení registrace sp.zn. sukls30927/2008 a příloha k sp.zn.: sukls84066/2011 PŘÍBALOVÁ INFORMACE: INFORMACE PRO UŽIVATELE SEDACORON Tablety Amiodaroni hydrochloridum Přečtěte

Více

KROK do digitální budoucnosti. Česká televize 2012 2017. Petr Dvořák

KROK do digitální budoucnosti. Česká televize 2012 2017. Petr Dvořák Česká televize 2012 2017 Petr Dvořák 14. Koncepce dalšího rozvoje a fungování České televize jako televize veřejné služby Srpen 2011 Strana 15 Slovo na úvod... Česká televize dnes stojí na prahu nové digitální

Více

Koncepce informování o evropských záležitostech v ČR na rok 2009 III.

Koncepce informování o evropských záležitostech v ČR na rok 2009 III. Koncepce informování o evropských záležitostech v ČR na rok 2009 III. Obsah Úvod... 3 1 Odbor informování o evropských záležitostech... 5 1.1 Spolupráce s resorty, poradní skupiny a mezinárodní spolupráce...

Více

V ČÍSLE: ROČNÍK 17. Rektor UP: Debata dokumentovala nepřipravenost části akademické obce ke změně loga. 13. června 2008

V ČÍSLE: ROČNÍK 17. Rektor UP: Debata dokumentovala nepřipravenost části akademické obce ke změně loga. 13. června 2008 Placeno převodem 706008 30 ROČNÍK 17 13. června 2008 V ČÍSLE: Nový AS UP zvolil své vedení Univerzitní pracoviště informují Představujeme držitele Ceny města Olomouce Na aktuální téma: zákon o univerzitních

Více

P R A V I D L A pro poskytování dotací z Programu podpory kultury pro rok 2016

P R A V I D L A pro poskytování dotací z Programu podpory kultury pro rok 2016 P R A V I D L A pro poskytování dotací z Programu podpory kultury pro rok 2016 I. Úvodní ustanovení 1. Poskytování dotací z programu podpory kultury se realizuje v souladu s následujícími právními normami:

Více

průvodce mobilní komunikace 5 Vybíráme handsfree do automobilu Historie společnosti TrendCar 3 Toyota Prius 2004/ 01 nejen o automobilech

průvodce mobilní komunikace 5 Vybíráme handsfree do automobilu Historie společnosti TrendCar 3 Toyota Prius 2004/ 01 nejen o automobilech nejen o automobilech 2004/ 01 magazín pro příznivce vozů Toyota vydává společnost TrendCar 1 Historie společnosti TrendCar výjimečná technickou vyspělostí 3 Toyota Prius 4 Prodej vozidel v dnešní době

Více

Ceník lícových cihel a dlažby TERCA Klinker

Ceník lícových cihel a dlažby TERCA Klinker Ceník lícových cihel a dlažby TERCA Klinker Architekt stavby: M. Doucet, B-Herent platný od 1. 8. 2010 Výjimečná krása. Neomezená životnost. OBSAH, DESATERO PRO LÍCOVÉ ZDIVO, KONTAKTY OBSAH LÍCOVÉ CIHLY

Více

Skeet 2016 - muži. Created in Master PDF Editor - Demo Version

Skeet 2016 - muži. Created in Master PDF Editor - Demo Version Skeet 2016 - muži SP CYP GP KUW Poř. Příjmení, jméno Roč. Klub SVK SVK SP SM 1.ČP HK 2.ČP Pl MMB+BB SVK GP HK 3.ČP Pís Perazzi Br.poh GP Plz OH Brno MČR VC AČR 4.ČP Br Max 1 Max 2 Max 3 Sum 3 Prům 3 Sum

Více

Aktualizované seznamy nositelů danů podle abededy k 29.2.2010

Aktualizované seznamy nositelů danů podle abededy k 29.2.2010 Aktualizované seznamy nositelů danů podle abededy k 29.2.2010 Příjmení Jméno nar. tech.stup. získal rok zk.komisař evid.číslo ZK oddíl/sk 1. Banszel Jaroslav 17.9.1960 3.dan 13.10.2007 Vele I/26/84 Sokol

Více

OBCE BRAŇANY ZPRACUJÍCÍ ORGÁN: OBECNÍ ÚŘAD BRAŇANY. Bc. Zděnka Šulcová účetní ekonomického oddělení OÚ

OBCE BRAŇANY ZPRACUJÍCÍ ORGÁN: OBECNÍ ÚŘAD BRAŇANY. Bc. Zděnka Šulcová účetní ekonomického oddělení OÚ OBEC BRAŇANY ZPRACUJÍCÍ ORGÁN: OBECNÍ ÚŘAD BRAŇANY SMĚRNICE K APLIKACI REÁLNÉ HODNOTY U MAJETKU URČENÉHO K PRODEJI OBCE BRAŇANY ZÁKON O ÚČETNICTVÍ - 27 VYHLÁŠKA Č. 410/2009 SB., 64 DRUH NORMY SMĚRNICE

Více

Příjezdový cestovní ruch 2015. Prezentace výsledků výzkumu březen 2016

Příjezdový cestovní ruch 2015. Prezentace výsledků výzkumu březen 2016 Příjezdový cestovní ruch 205 Prezentace výsledků výzkumu březen 206 Obsah prezentace Odhad počtu zahraničních návštěvníků a jejich výdajů Charakteristiky zahraničních návštěvníků Ověřování výdajů Ověřování

Více

Místní Informační Zpravodaj

Místní Informační Zpravodaj Místní Informační Zpravodaj ČTRNÁCTIDENÍK 25. listopadu 2010 náklad 500 ks CENA 8,- Vydává: Město Vejprty Tylova 870/6, Vejprty 431 91 e-mail: miz@vejprty.cz tel.: 731 449 167 22 ČÍSLO VEJPRTY BÄRENSTEIN

Více

ZKUŠEBNÍ ŘÁD & SMĚRNICE PRO SOUTĚŽE OBEDIENCE VE TŘÍDÁCH 1 & 2 & 3

ZKUŠEBNÍ ŘÁD & SMĚRNICE PRO SOUTĚŽE OBEDIENCE VE TŘÍDÁCH 1 & 2 & 3 FEDERATION CYNOLOGIQUE INTERNATIONALE (FCI) (AISBL) Place Albert 1 er, 13, B 6530 Thuin (Belgique), tel : +32.71.59.12.38, fax : +32.71.59.22.29, internet: www.fci.be ZKUŠEBNÍ ŘÁD & SMĚRNICE PRO SOUTĚŽE

Více

VYSOKÉ UČENÍ TECHNICKÉ V BRNĚ BRNO UNIVERSITY OF TECHNOLOGY

VYSOKÉ UČENÍ TECHNICKÉ V BRNĚ BRNO UNIVERSITY OF TECHNOLOGY VYSOKÉ UČENÍ TECHNICKÉ V BRNĚ BRNO UNIVERSITY OF TECHNOLOGY FAKULTA ELEKTROTECHNIKY A KOMUNIKAČNÍCH TECHNOLOGIÍ ÚSTAV AUTOMATIZACE A MĚŘICÍ TECHNIKY FACULTY OF ELECTRICAL ENGINEERING AND COMMUNICATION

Více

DOMOVY MLÁDEŽE Ubytovaní žáci středních škol a konzervatoří Příloha č. 6a

DOMOVY MLÁDEŽE Ubytovaní žáci středních škol a konzervatoří Příloha č. 6a Č.j.: MSMT-20795/2016 DOMOVY MLÁDEŽE Ubytovaní žáci středních škol a konzervatoří Příloha č. 6a Porovnání krajskch normativů mzdovch prostředků a ostatních neinvestičních vdajů stanovench jednotlivmi krajskmi

Více

MADONE 7 SERIES SILNIČNÍ KOLA // RACE MADONE 7.9 // MADONE 7.9 PROJECT ONE // MADONE 7.7. 70 www.bretton.cz

MADONE 7 SERIES SILNIČNÍ KOLA // RACE MADONE 7.9 // MADONE 7.9 PROJECT ONE // MADONE 7.7. 70 www.bretton.cz MADONE 7.9 // MADONE 7.9 PROJECT ONE // MADONE 7.7 MADONE 7 SERIES PROČ MADONE 7 SERIES? Úplně nová řada silničních kol TREK Madone 7 představuje absolutní vrchol technologií silničních kol. Rámy jsou

Více

Jiří Matas. Detekce objektů pomocí scanning window

Jiří Matas. Detekce objektů pomocí scanning window Detekce objektů pomocí scanning window Jiří Matas Center for Machine Perception Department of Cybernetics, Faculty of Electrical Engineering Czech Technical University, Prague Osnova přednášky: Formulace

Více

DOMOVY MLÁDEŽE Ubytovaní studenti vyšších odborných škol Příloha č. 6b

DOMOVY MLÁDEŽE Ubytovaní studenti vyšších odborných škol Příloha č. 6b Č.j.: MSMT-26181/2014 DOMOVY MLÁDEŽE Ubytovaní studenti vyšších odbornch škol Příloha č. 6b Porovnání krajskch normativů mzdovch prostředků a ostatních neinvestičních vdajů stanovench jednotlivmi krajskmi

Více

Zkušenosti s cementovaným anatomicky tvarovaným dříkem SAS I střednědobé výsledky

Zkušenosti s cementovaným anatomicky tvarovaným dříkem SAS I střednědobé výsledky 145/, p. 145 151 Zkušenosti s cementovaným anatomicky tvarovaným dříkem SAS I střednědobé výsledky Use of the Anatomical Cemented Femoral Stem SAS I: Mid-Term Results M. MIKLÁŠ, M. PINK, T. VALOUŠEK Ortopedické

Více

NOVÉ TRENDY A MATERIÁLY POUŽÍVANÉ PŘI KONSTRUKCI RÁMŮ JÍZDÍCH KOL

NOVÉ TRENDY A MATERIÁLY POUŽÍVANÉ PŘI KONSTRUKCI RÁMŮ JÍZDÍCH KOL VYSOKÉ UČENÍ TECHNICKÉ V BRNĚ BRNO UNIVERSITY OF TECHNOLOGY FAKULTA STROJNÍHO INŽENÝRSTVÍ ÚSTAV MATERIÁLOVÝCH VĚD A INŽENÝRSTVÍ FACULTY OF MECHANICAL ENGINEERING INSTITUTE OF MATERIALS SCIENCE AND ENGINEERING

Více

DOMOVY MLÁDEŽE Ubytovaní žáci středních škol a konzervatoří Příloha č. 6a

DOMOVY MLÁDEŽE Ubytovaní žáci středních škol a konzervatoří Příloha č. 6a Č.j.: MSMT-10449/2015 DOMOVY MLÁDEŽE Ubytovaní žáci středních škol a konzervatoří Porovnání krajskch normativů mzdovch prostředků a ostatních neinvestičních vdajů stanovench jednotlivmi krajskmi úřady

Více

Informace členům březen 2015

Informace členům březen 2015 Informace členům březen 2015 Vážení členové České botanické společnosti, obsahem letošních březnových informací je kromě pozvánek na jarní exkurze poboček i ústředí ČBS také přihláška na letní floristické

Více

Bezpečnost cyklistické dopravy

Bezpečnost cyklistické dopravy Bezpečnost cyklistické dopravy Ing. Jaroslav Martinek Národní koordinátor rozvoje cyklistické dopravy v ČR Obsah Úvod - představení Statistiky nehodovosti v ČR Příčiny nehodovosti Srovnání s Nizozemskem

Více

VYSOKÉ UČENÍ TECHNICKÉ V BRNĚ BRNO UNIVERSITY OF TECHNOLOGY

VYSOKÉ UČENÍ TECHNICKÉ V BRNĚ BRNO UNIVERSITY OF TECHNOLOGY VYSOKÉ UČENÍ TECHNICKÉ V BRNĚ BRNO UNIVERSITY OF TECHNOLOGY ÚSTAV SOUDNÍHO INŽENÝRSTVÍ INSTITUT OF FORENSIC ENGINEERING VYHODNOCENÍ LEGISLATIVNÍCH PŘEDPISŮ PRO SPECIÁLNÍ SILNIČNÍ PŘEPRAVU MEZI ČESKOU REPUBLIKOU

Více

MĚSTSKÝ ÚŘAD ZÁBŘEH stavební a vyvlastňovací úřad Masarykovo nám. 6, 789 01 Zábřeh, tel.: 583 468 111, ID DS: hk9bq2f

MĚSTSKÝ ÚŘAD ZÁBŘEH stavební a vyvlastňovací úřad Masarykovo nám. 6, 789 01 Zábřeh, tel.: 583 468 111, ID DS: hk9bq2f MĚSTSKÝ ÚŘAD ZÁBŘEH stavební a vyvlastňovací úřad Masarykovo nám. 6, 789 01 Zábřeh, tel.: 583 468 111, ID DS: hk9bq2f Spisová zn. Výst. 116/2011/Bre Zábřeh, dne 19.12.2011 Č.j. 2011/116/SV-MUZB-125 Vyřizuje:

Více

RNDr. Stanislav Novák Prakšická 990 688 01 Uherský Brod poradenství v ekologii a životním prostředí OZNÁMENÍ. záměru

RNDr. Stanislav Novák Prakšická 990 688 01 Uherský Brod poradenství v ekologii a životním prostředí OZNÁMENÍ. záměru RNDr. Stanislav Novák Prakšická 990 688 01 Uherský Brod poradenství v ekologii a životním prostředí OZNÁMENÍ záměru "Obalovna firmy SWIETELSKY stavební s.r.o. - Přerov" podle zákona č. 100/2001 Sb. o posuzování

Více

STUDIE VELKOKAPACITNÍCH NÁKLADNÍCH SOUPRAV PRO SILNIČNÍ DOPRAVU

STUDIE VELKOKAPACITNÍCH NÁKLADNÍCH SOUPRAV PRO SILNIČNÍ DOPRAVU VYSOKÉ UČENÍ TECHNICKÉ V BRNĚ BRNO UNIVERSITY OF TECHNOLOGY FAKULTA STROJNÍHO INŽENÝRSTVÍ ÚSTAV AUTOMOBILNÍHO A DOPRAVNÍHO INŽENÝRSTVÍ FACULTY OF MECHANICAL ENGINEERING INSTITUTE OF AUTOMOTIVE ENGINEERING

Více

Rozpis poháru. 3. Měřené tréninky a závody započítávané do Poháru KvSC:

Rozpis poháru. 3. Měřené tréninky a závody započítávané do Poháru KvSC: Pohár Karlovarského svazu cyklistiky v silniční cyklistice pro talentovanou mládež 2015 a Pohár Karlovarského svazu cyklistiky v silniční cyklistice 2015 Rozpis poháru 1. Pohár KvSC v silniční cyklistice

Více

VÝVOZNÍ SUBVENCE PRO DRŮBEŽÍ MASO, ŽIVÁ KUŘATA A VEJCE

VÝVOZNÍ SUBVENCE PRO DRŮBEŽÍ MASO, ŽIVÁ KUŘATA A VEJCE VÝVOZNÍ SUBVENCE PRO DRŮBEŽÍ MASO, ŽIVÁ KUŘATA A VEJCE Vývozcům ze Společenství jsou z Evropského zemědělského orientačního a garančního fondu poskytovány subvence při vývozu (vývozní subvence, vývozní

Více

horké krize studené války

horké krize studené války Vladimír Nálevka horké krize studené války VYŠEHRAD Ukázka knihy z internetového knihkupectví www.kosmas.cz Copyright Vladimír Nálevka, 2010 ISBN 978-80-7429-011-4 OBSAH Úvod................................................

Více

Martina Šrámková DOBA KRKAVCŸ

Martina Šrámková DOBA KRKAVCŸ Martina Šrámková DOBA KRKAVCŸ Martina Šrámková DOBA KRKAVCŸ Věnováno kocouru Jonášovi, který už líhá na jiných psacích stolech v kočičím nebi. Copyright Martina Šrámková, 2009 Cover Karel Zeman & Lukáš

Více

VYSOKÉ UČENÍ TECHNICKÉ V BRNĚ BRNO UNIVERSITY OF TECHNOLOGY

VYSOKÉ UČENÍ TECHNICKÉ V BRNĚ BRNO UNIVERSITY OF TECHNOLOGY VYSOKÉ UČENÍ TECHNICKÉ V BRNĚ BRNO UNIVERSITY OF TECHNOLOGY FAKULTA STAVEBNÍ ÚSTAV GEOTECHNIKY FACULTY OF CIVIL ENGINEERING INSTITUTE OF GEOTECHNICS METODY REALIZACE KONSTRUKCÍ MĚLKÝCH PODZEMNÍCH STAVEB

Více

Hrádek - Rohozná D - Podzemní stavby hlubinného úložiště TECHNICKÁ ZPRÁVA Vypracoval kolektiv

Hrádek - Rohozná D - Podzemní stavby hlubinného úložiště TECHNICKÁ ZPRÁVA Vypracoval kolektiv Název zakázky: Název dokumentace: Značka 4000/Fie EGP INVEST, spol. s r. o., Antonína Dvořáka 1707, 688 01 Uherský Brod Tel.: 572 610 311; Fax: 572 633 725, E-mail: egpi@egpi.cz Lokalita Hrádek - Rohozná

Více

FRANK. Technologie pro stavební průmysl. Egcovoid. Setzungsplatte bednění plánovaných dutin v základových konstrukcích

FRANK. Technologie pro stavební průmysl. Egcovoid. Setzungsplatte bednění plánovaných dutin v základových konstrukcích FRANK Technologie pro stavební průmysl Egcovoid Setzungsplatte bednění plánovaných dutin v základových konstrukcích Egcovoid Setzungsplatte bednění dutin Max Frank GmbH & Co. KG Mitterweg 1 94339 Leiblfing

Více

Ohlášení stavby. nové stavby nástavby přístavby stavební úpravy změny stavby před dokončením ČÁST A.

Ohlášení stavby. nové stavby nástavby přístavby stavební úpravy změny stavby před dokončením ČÁST A. MĚSTSKÝ ÚŘAD UHERSKÉ HRADIŠTĚ Odbor dopravy Masarykovo náměstí 19 686 01 Uherské Hradiště odloučené pracoviště: Revoluční 1023 Ohlášení stavby podle ustanovení 104 odst. 2 písm. a) až d) zákona č. 183/2006

Více

Letecký stavební úřad Letiště Ruzyně 160 08 Praha 6. V... dne...

Letecký stavební úřad Letiště Ruzyně 160 08 Praha 6. V... dne... Příloha č. 1 k vyhlášce č. 526/2006 Sb. Úřad pro civilní letectví Letecký stavební úřad Letiště Ruzyně 160 08 Praha 6 V... dne...... Věc: OHLÁŠENÍ STAVBY podle ustanovení 104 odst. 2 písm. a) až d) zákona

Více

Univerzita Karlova v Praze. Právnická fakulta. Vztah podzemní stavby k vlastnictví pozemku

Univerzita Karlova v Praze. Právnická fakulta. Vztah podzemní stavby k vlastnictví pozemku Univerzita Karlova v Praze Právnická fakulta Vztah podzemní stavby k vlastnictví pozemku Studentská vědecká a odborná činnost Kategorie: magisterské 2015 spoluautoři: Jiří Culka, Martin Richter VIII. ročník

Více

PÁTRÁNÍ PO KRITICKÉ SOCIÁLNÍ PRÁCI V ČESKÉ REPUBLICE THE SEARCH FOR 'CRITICAL SOCIAL WORK' IN THE CZECH REPUBLIC. Radka Janebová

PÁTRÁNÍ PO KRITICKÉ SOCIÁLNÍ PRÁCI V ČESKÉ REPUBLICE THE SEARCH FOR 'CRITICAL SOCIAL WORK' IN THE CZECH REPUBLIC. Radka Janebová PÁTRÁNÍ PO KRITICKÉ SOCIÁLNÍ PRÁCI V ČESKÉ REPUBLICE THE SEARCH FOR 'CRITICAL SOCIAL WORK' IN THE CZECH REPUBLIC Radka Janebová Abstract: 'Critical social work' is not theoretically embedded in the Czech

Více

Návod k použití WAE 24160 BY B-674-01

Návod k použití WAE 24160 BY B-674-01 Návod k použití WAE 24160 BY B-674-01 1 2 1 2 3 3 4 5 6 i 7 8 9 10 11 INFORMAČNÍ LIST: BSH domácí spotřebiče, s. r. o. Obchodní značka BSH: BOSCH Název / Označení modelu WAE 24160 BY Třída spotřeby A

Více

TX-L32BL6E TX-L39BL6E TX-L50BL6E. enápověda. Česky

TX-L32BL6E TX-L39BL6E TX-L50BL6E. enápověda. Česky TX-L32BL6E TX-L39BL6E TX-L50BL6E enápověda Česky Sledování Moje úvod. obrazovka Informace 10 Použití 11 Nastavení 12 Základy Zapojení 14 Výběr kanálu 16 Informační pruh 18 Volby 20 Titulky 22 Časovač vypnutí

Více

R O Z S U D E K J M É N E M R E P U B L I K Y

R O Z S U D E K J M É N E M R E P U B L I K Y 4 As 154/2015-34 ČESKÁ REPUBLIKA R O Z S U D E K J M É N E M R E P U B L I K Y Nejvyšší správní soud rozhodl v senátě složeném z předsedy JUDr. Jiřího Pally a soudců Mgr. Aleše Roztočila a JUDr. Dagmar

Více

Při koupi vaší nové pračky jste se rozhodli pro moderní, kvalitativně vysoce hodnotný domácí spotřebič.

Při koupi vaší nové pračky jste se rozhodli pro moderní, kvalitativně vysoce hodnotný domácí spotřebič. Obsah Strana Bezpečnostní pokyny... 4 Ochrana životního prostředí/pokyny pro úsporu... 4 Obal a spotřebič, který dosloužil... 4 To je vaše pračka... 5 1 - Návod pro instalaci Odstranění přepravní pojistky...

Více

Návod k použití TWK 86.

Návod k použití TWK 86. Návod k použití TWK 86. Q4ACZM1431 1 2 Návod k použití si pečlivě pročtěte, podle něj postupujte a dobře uschovejte! Bezpečnostní pokyny Tento spotřebič je určen pro domácnost, ne ke komerčním účelům.

Více

Extremismus v České republice po roce 1989 a jeho vliv na dospívající mládež. David Fejta

Extremismus v České republice po roce 1989 a jeho vliv na dospívající mládež. David Fejta Extremismus v České republice po roce 1989 a jeho vliv na dospívající mládež David Fejta Bakalářská práce 2014 ABSTRAKT Bakalářská práce Extremismus v České republice po roce 1989 a jeho vliv na dospívající

Více

Hlavní tendence ve vývoji pracovních migrací v České republice

Hlavní tendence ve vývoji pracovních migrací v České republice WORKING PAPER č. 22/2006 Hlavní tendence ve vývoji pracovních migrací v České republice Aleš Franc Červen 2006 Řada studií Working Papers Centra výzkumu konkurenční schopnosti české ekonomiky je vydávána

Více

Výsledky projektu PREDICTIVE v Èeské republice

Výsledky projektu PREDICTIVE v Èeské republice Původní práce Výsledky projektu PREDICTIVE v Èeské republice M. Honka Interní klinika FN Ostrava, přednosta doc. MUDr. Arnošt Martínek, CSc. Souhrn: Úvod: Projekt PREDICTIVE byl mezinárodní multicentrickou,

Více

TERÉNNÍ SOCIÁLNÍ PRÁCE

TERÉNNÍ SOCIÁLNÍ PRÁCE 1 Masarykova univerzita Pedagogická fakulta KATEDRA SOCIÁLNÍ PEDAGOGIKY TERÉNNÍ SOCIÁLNÍ PRÁCE Bakalářská práce Brno 2006 Vedoucí bakalářské práce: Mgr. Ema Štěpařová Vypracovala: Jana Balážová 2 Prohlašuji,

Více

Normální hodnoty erytropoézy

Normální hodnoty erytropoézy Anémie - kazuistiky 1/ Normální hodnoty erytropoézy 2/ Dif dg laboratorní nálezy 3/ Anémie sideropenická 4/ Anémie makrocytová 5/ Anémie hemolytická sekundární u CLL 6/ Multifaktoriální anémie - u Idiopatických

Více

Výše příspěvku na likvidaci historických elektrozařízení

Výše příspěvku na likvidaci historických elektrozařízení Výše příspěvku na likvidaci historických elektrozařízení druh elektrozařízení výše příspěvku bez DPH výše příspěvku vč. DPH pračky 75,63 Kč 90 Kč sušičky 75,63 Kč 90 Kč myčky 75,63 Kč 90 Kč sporáky, trouby

Více

Cílem mé bakaláské práce bylo poskytnout pehled o problematice geneticky modifikovaných organism. Práce je rozdlena do nkolika kapitol, ve kterých

Cílem mé bakaláské práce bylo poskytnout pehled o problematice geneticky modifikovaných organism. Práce je rozdlena do nkolika kapitol, ve kterých Cílem mé bakaláské práce bylo poskytnout pehled o problematice geneticky modifikovaných organism. Práce je rozdlena do nkolika kapitol, ve kterých samostatn popíši jednotlivé oblasti, kde se geneticky

Více

Návod k použití WAE 24442BY B-953-01

Návod k použití WAE 24442BY B-953-01 Návod k použití WAE 24442BY B-953-01 Uveďte pračku do provozu teprve po přečtení tohoto návodu a samostatného Návodu k instalaci! Ekologická likvidace Obalový materiál ekologicky zlikvidujte. Tento spotřebič

Více

Návod k použití WLX 2448KBY

Návod k použití WLX 2448KBY Návod k použití WLX 2448KBY Q4ACZM1108 1 Vaše pračka.. Blahopřejeme - rozhodli jste se pro moderní, kvalitativně vysoce hodnotný domácí spotřebič značky Bosch. Pračka se vyznačuje malou spotřebou vody

Více

Research activities in the field of design and virtual prototyping 2013

Research activities in the field of design and virtual prototyping 2013 Research activities in the field of design and virtual prototyping 2013 Ing. David Paloušek, Ph.D. It is important to remember that every person is different and has to be motivated differently. Mike Krzyzewski

Více

KRAJINA RÝCHOR VYUŽITÍ PLOCH V MINULOSTI

KRAJINA RÝCHOR VYUŽITÍ PLOCH V MINULOSTI UNIVERZITA PALACKÉHO V OLOMOUCI Přírodovědecká fakulta Katedra geografie Bc. Josef KOSINA KRAJINA RÝCHOR VYUŽITÍ PLOCH V MINULOSTI Diplomová práce Vedoucí práce: Mgr. Pavel Klapka, Ph.D. Olomouc 2014 Bibliografický

Více

v historických souvislostech

v historických souvislostech Agrolesnictví v historických souvislostech Ing. Antonín Martiník Ph.D Tento projekt je spolufinancován Evropským sociálním fondem a Státním rozpočtem ČR InoBio CZ.1.07/2.2.00/28.0018 Charakteristiky (fenomény)

Více

Metodika práce asistenta pedagoga Podpora komunikace mezi žáky Jonáš Habr, Anežka Šoubová, Vendula Rohlenová

Metodika práce asistenta pedagoga Podpora komunikace mezi žáky Jonáš Habr, Anežka Šoubová, Vendula Rohlenová Metodika práce asistenta pedagoga Podpora komunikace mezi žáky Jonáš Habr, Anežka Šoubová, Vendula Rohlenová Pracovní verze Neprošlo jazykovou a redakční úpravou Určeno k ověření v praxi Univerzita Palackého

Více

Porovnávání minulých časů s přítomností může vést k různým úvahám i otázkám.

Porovnávání minulých časů s přítomností může vést k různým úvahám i otázkám. I. Úvod do dějepisu A. Dějiny a dějepis Jistě každý člověk cítí, že čas a jeho plynutí jsou důležitým rysem našeho světa. Již pohled do rodinného fotografického alba nám naznačí, jak se s časem všechno

Více

HRANICE VE SVĚTĚ ŠKOLNÍ TŘÍDY 1 BORDERS IN THE WORLD OF A CLASSROOM

HRANICE VE SVĚTĚ ŠKOLNÍ TŘÍDY 1 BORDERS IN THE WORLD OF A CLASSROOM SBORNÍK PRACÍ FILOZOFICKÉ FAKULTY BRNĚNSKÉ UNIVERZITY STUDIA MINORA FACULTATIS PHILOSOPHICAE UNIVERSITATIS BRUNENSIS U 12, 2007 MAGDALENA DVOŘÁKOVÁ HRANICE VE SVĚTĚ ŠKOLNÍ TŘÍDY 1 BORDERS IN THE WORLD

Více

Závěrečná evaluace kurzů DVPP zaměřených na sociální znevýhodnění

Závěrečná evaluace kurzů DVPP zaměřených na sociální znevýhodnění Závěrečná evaluace kurzů DVPP zaměřených na sociální znevýhodnění Zpracování výstupů z evaluačních dotazníků účastníků a lektorů z kurzů DVPP realizovaných ČvT v období leden 2014 květen 2015 LOHROVACÍ

Více

Postup řešení: Základy pro lehké ocelové konstrukce pro bydlení

Postup řešení: Základy pro lehké ocelové konstrukce pro bydlení Postup řešení: Základy pro lehké ocelové konstrukce pro bydlení Stručně se popisuje užití betonových desek, základových pásů a lehkých pilotových systémů pro základy lehkých ocelových obytných konstrukcí.

Více

Výroční zpráva za rok 2015 o činnosti Ministerstva práce a sociálních věcí v oblasti poskytování informací

Výroční zpráva za rok 2015 o činnosti Ministerstva práce a sociálních věcí v oblasti poskytování informací Výroční zpráva za rok 2015 o činnosti Ministerstva práce a sociálních věcí v oblasti poskytování informací Výroční zpráva za rok 2015 o činnosti Ministerstva práce a sociálních věcí v oblasti poskytování

Více

PŘÍLOHA č. 29 Seznam institucí a dalších subjektů, jejich činnost související s výkonem sociálně-právní ochrany dětí v Jihočeském kraji

PŘÍLOHA č. 29 Seznam institucí a dalších subjektů, jejich činnost související s výkonem sociálně-právní ochrany dětí v Jihočeském kraji PŘÍLOHA č. 29 Seznam institucí a dalších subjektů, jejich činnost související s výkonem sociálně-právní ochrany dětí v Jihočeském kraji SOUDY Název Adresa Spojení Krajský soud v Českých Budějovicích Okresní

Více

Nabídka cateringu. pro Vaše coffee breaky, oslavy, rauty a další akce. Nabídka platná od 1. 9. 2016

Nabídka cateringu. pro Vaše coffee breaky, oslavy, rauty a další akce. Nabídka platná od 1. 9. 2016 Nabídka cateringu pro Vaše coffee breaky, oslavy, rauty a další akce Nabídka platná od 1. 9. 2016 Provozovna: BEATA lunch and coffee, tř. Kosmonautů 1, 779 00 Olomouc (BEA campus Olomouc) www.cafebeata.cz

Více

Vyšší odborná škola, střední odborná škola a základní škola MILLS s.r.o. Achalázie jícnu, onemocnění jícnu a trávicího traktu, léčba

Vyšší odborná škola, střední odborná škola a základní škola MILLS s.r.o. Achalázie jícnu, onemocnění jícnu a trávicího traktu, léčba Vyšší odborná škola, střední odborná škola a základní škola MILLS s.r.o. Achalázie jícnu, onemocnění jícnu a trávicího traktu, léčba Diplomovaný farmaceutický asistent Vedoucí práce: Mgr Jitka Havlíčková

Více

Seminární práce ZAJÍMAVÁ POMŮCKA (med)

Seminární práce ZAJÍMAVÁ POMŮCKA (med) Seminární práce ZAJÍMAVÁ POMŮCKA (med) do předmětu MSBP_PPS Praktikum k poznávání přírody a společnosti UČO: 425658 jméno: Kamenická Pavla akademický rok 2013/2014 ----------------------------------------------------------------------------------------------------------------------------------------------

Více

Návod k použití WS 10X461 BY WS 12X441 BY WS 12X461 BY SM191-01

Návod k použití WS 10X461 BY WS 12X441 BY WS 12X461 BY SM191-01 Návod k použití WS 10X461 BY WS 12X441 BY WS 12X461 BY SM191-01 1 Vaše pračka Blahopřejeme - rozhodli jste se pro moderní, kvalitativně vysoko hodnotný domácí spotřebič značky Siemens. Pračka se vyznačuje

Více

Návod k použití WLX 20261BY

Návod k použití WLX 20261BY WLX 20261 Návod k použití WLX 20261BY Q4ACZM2222 1 Obsah Strana Vaše pračka...3 Účel použití...4 Příprava...5 Třídění a vložení prádla...6 Naplnění pracího a ošetřovacího prostředku...6 Nastavení programu...6

Více

Domácí spotřebiče. jaro léto 2014. www.bosch-home.com/cz

Domácí spotřebiče. jaro léto 2014. www.bosch-home.com/cz Domácí spotřebiče jaro léto 2014 www.bosch-home.com/cz 2 Nové evropské energetické štítky Větší přehled o menší spotřebě Nové evropské energetické štítky Domácí spotřebiče jsou zodpovědné za více než polovinu

Více

4. březen 2013 8. březen 2013

4. březen 2013 8. březen 2013 Fio report ní zpravodajství z kapitálových trhů 4. březen 2013 8. březen 2013 ČR Vývoj indexu PX 5/3 Morgan Stanley zvyšuje doporučení pro Erste Bank z equal weight" na overweight". Minulý PX 1013,1 1038,89

Více

Týden vánočních receptů

Týden vánočních receptů Týden vánočních receptů Naše teta peče léta na Vánoce vánočku, nereptáme, aspoň máme něco pro kočku. Už vám někdy nahánělo hrůzu, že se trable z této písničky přihodí i vám? Dá se na to snadno vyzrát stačí

Více

Agrolesnictví v historických souvislostech

Agrolesnictví v historických souvislostech Agrolesnictví v historických souvislostech Tento projekt je spolufinancován Evropským sociálním fondem a Státním rozpočtem ČR InoBio CZ.1.07/2.2.00/28.0018 Vznik vývoj a perspektivy agrolesnictví Současný

Více

Modulární systém dalšího vzdělávání pedagogických pracovníků JmK v přírodních vědách a informatice CZ.1.07/1.3.10/02.0024. Co je Krajina?

Modulární systém dalšího vzdělávání pedagogických pracovníků JmK v přírodních vědách a informatice CZ.1.07/1.3.10/02.0024. Co je Krajina? Modulární systém dalšího vzdělávání pedagogických pracovníků JmK v přírodních vědách a informatice CZ.1.07/1.3.10/02.0024 Co je Krajina? a co nám sama nabízí (i pro výuku) Jan Trávníček Masarykova univerzita,

Více

Místo na slunci. Věra Semerádová. OBSAH Boj o místo na slunci. Vlivní a oblíbení? Jak se navzájem vidí. Závěrem. Poznámky BOJ O MÍSTO NA SLUNCI

Místo na slunci. Věra Semerádová. OBSAH Boj o místo na slunci. Vlivní a oblíbení? Jak se navzájem vidí. Závěrem. Poznámky BOJ O MÍSTO NA SLUNCI Místo na slunci Věra Semerádová OBSAH Boj o místo na slunci Vlivní a oblíbení? Jak se navzájem vidí Závěrem Poznámky BOJ O MÍSTO NA SLUNCI Společenství školní třídy je obraz světa v malém. I tady jsou

Více

1. Úvod KRAJINA A REVOLUCE

1. Úvod KRAJINA A REVOLUCE 1. Úvod KRAJINA A REVOLUCE Hrdé a zkratkovité soudy: Neolitická revoluce!, Vûdecko-technická revoluce souãasnosti!, Kulturní krajina a její moderní devastace! Na druhé stranû jistû není náhodou, Ïe se

Více

TŘÍDNICKÁ HODINA. Obsahové, časové a organizační vymezení třídnické hodiny

TŘÍDNICKÁ HODINA. Obsahové, časové a organizační vymezení třídnické hodiny ZÁKLADNÍ ŠKOLA OLOMOUC příspěvková organizace MOZARTOVA 48, 779 00 OLOMOUC tel.: 585 427 142, 775 116 442; fax: 585 422 713 e-mail: kundrum@centrum.cz; www.zs-mozartova.cz TŘÍDNICKÁ HODINA Třídnická hodina

Více

SILNICE A DÁLNICE I POZEMNÍ KOMUNIKACE pomocný text k přednáškám

SILNICE A DÁLNICE I POZEMNÍ KOMUNIKACE pomocný text k přednáškám SILNICE A DÁLNICE I POZEMNÍ KOMUNIKACE pomocný text k přednáškám Ing. Karel Pospíšil, Ph.D. TENTO TEXT JE MOŽNO POUŽÍT POUZE KE STUDIJNÍM ÚČELŮM STUDENTY UVEDENÝCH PŘEDMĚTŮ DFJP UP. NESMÍ BÝT ŠÍŘEN A POSKYTOVÁN

Více

PREVENTIVNÍ PROGRAM ZŠ A MŠ JANKOV

PREVENTIVNÍ PROGRAM ZŠ A MŠ JANKOV PREVENTIVNÍ PROGRAM ZŠ A MŠ JANKOV ŠKOLNÍ ROK 2015/2016 zpracovala: Jitka Peroutková OBSAH: 1 Úvod 2 Popis současného stavu problematiky 2.1 Charakteristika školy 2.2 Analýza současného stavu ve škole

Více

Sbírka zákonů ČR Předpis č. 13/1997 Sb. Zákon o pozemních komunikacích. Ze dne 23.01.1997 Částka 3/1997 Účinnost od 01.04.1997 Znění 31.12.

Sbírka zákonů ČR Předpis č. 13/1997 Sb. Zákon o pozemních komunikacích. Ze dne 23.01.1997 Částka 3/1997 Účinnost od 01.04.1997 Znění 31.12. Sbírka zákonů ČR Předpis č. 13/1997 Sb. Zákon o pozemních komunikacích Ze dne 23.01.1997 Částka 3/1997 Účinnost od 01.04.1997 Znění 31.12.2015 Parlament se usnesl na tomto zákoně České republiky: ČÁST

Více

Sociální klima třídy na 1. stupni základní školy

Sociální klima třídy na 1. stupni základní školy Jihočeská univerzita v Českých Budějovicích Pedagogická fakulta Oddělení celoživotního vzdělávání Závěrečná práce Sociální klima třídy na 1. stupni základní školy Vypracovala: Mgr. Stanislava Kubátová

Více

Mariánské Lázně. CZ Úchvatná příroda, čistý vzduch, klimatické podmínky, lázeňské lesy a parky, skvostná architektura,

Mariánské Lázně. CZ Úchvatná příroda, čistý vzduch, klimatické podmínky, lázeňské lesy a parky, skvostná architektura, MA R I Á N S K É L Á Z N Ě Mariánské Lázně Marienbad Марианские Лазни Tradice lázní od roku 1818 Spa tradition from 1818 Kurtradition seit dem Jahre 1818 Курортные традиции с 1818 года CZ Úchvatná příroda,

Více

Silnice s uspořádáním 2+1 Ing. Petr Pokorný a Ing. Martin Lipl, Centrum dopravního výzkumu, v.v.i

Silnice s uspořádáním 2+1 Ing. Petr Pokorný a Ing. Martin Lipl, Centrum dopravního výzkumu, v.v.i Silnice s uspořádáním 2+1 Ing. Petr Pokorný a Ing. Martin Lipl, Centrum dopravního výzkumu, v.v.i Šířkové uspořádání 2+1 (neboli navýšení počtu jízdních pruhů dvoupruhové silnice o další jízdní pruh, který

Více

Hledání výzkumného nástroje pro měření klimatu středoškolské třídy 1. in a grammar school class

Hledání výzkumného nástroje pro měření klimatu středoškolské třídy 1. in a grammar school class SBORNÍK PRACÍ FILOZOFICKÉ FAKULTY BRNĚNSKÉ UNIVERZITY STUDIA MINORA FACULTATIS PHILOSOPHICAE UNIVERSITATIS BRUNENSIS U 11, 2006 František Špaček Hledání výzkumného nástroje pro měření klimatu středoškolské

Více

Novela školského zákona

Novela školského zákona Novela školského zákona V únoru 2015 Poslanecká sněmovna schválila návrh novely školského zákona a některých dalších zákonů (zákona o poskytování dotací soukromým školám, předškolním a školským zařízením,

Více

SPORTOVNĚ REKREAČNÍ AREÁL VRCHBĚLÁ MULTIFUNKČNÍ TURISTICKÉ CENTRUM

SPORTOVNĚ REKREAČNÍ AREÁL VRCHBĚLÁ MULTIFUNKČNÍ TURISTICKÉ CENTRUM Sídlo: Doudova 544/11, 147 00 Praha 4 Podolí Provozovna: Masarykova 62/109, 400 01 Ústí nad Labem IČ: 25423363, DIČ: CZ25423363 Název akce: SPORTOVNĚ REKREAČNÍ AREÁL VRCHBĚLÁ MULTIFUNKČNÍ TURISTICKÉ CENTRUM

Více

Schémata elektrických obvodů

Schémata elektrických obvodů Schémata elektrických obvodů Schémata elektrických obvodů Číslo linie napájení Elektrický obvod 30 Propojení s kladným pólem akumulátorové baterie 31 Kostra 15, 15a Propojení s kladným pólem akumulátorové

Více

Lenovo. Uživatelská příručka. Před používáním počítače si přečtěte bezpečnostní upozornění a důležité rady v dodaných příručkách.

Lenovo. Uživatelská příručka. Před používáním počítače si přečtěte bezpečnostní upozornění a důležité rady v dodaných příručkách. Lenovo Uživatelská příručka Před používáním počítače si přečtěte bezpečnostní upozornění a důležité rady v dodaných příručkách. Poznámky Před používáním výrobku si přečtěte Příručka s bezpečnostními a

Více

Navigátor pro Android Manuál. 2015... MapFactor s.r.o.

Navigátor pro Android Manuál. 2015... MapFactor s.r.o. Navigátor pro Android Manuál I Navigator pro Android Obsah 0 Část I Úvod 4 Část II Instalace Navigátoru 6 1 Instalace aplikace... Navigátor 6 2 Instalace map... 7 Část III Práce s Navigátorem 14 1 Zadání

Více

Pravidla pro používání Klientské zóny České pojišťovny a.s.

Pravidla pro používání Klientské zóny České pojišťovny a.s. Pravidla pro používání Klientské zóny České pojišťovny a.s. I. Úvodní ustanovení 1. Klientskou zónou České pojišťovny a.s. (dále též KZ ) se rozumí aplikace dostupná na internetových stránkách České pojišťovny

Více

Návod pro uživatele DS150E. Dangerfield May 2009 V3.0 Delphi PSS

Návod pro uživatele DS150E. Dangerfield May 2009 V3.0 Delphi PSS Návod pro uživatele DS150E 1 OBSAH Hlavní součásti...3 Zápis do elektronické řídicí jednotky (OBD)...86 Pokyny k instalaci......5 Skenování... 89 Konfigurace technologie Bluetooth...26 Diagnostický program...39

Více

Drobný hmotný majetek

Drobný hmotný majetek DLOUHODOBÝ HMOTNÝ MAJETEK DLO str. 1 HESLA MAJÍ PEVNĚ STANOVENOU STRUKTURU Drobný hmotný majetek Právní úprava: Vyhláška č. 500/2002 Sb., ve znění pozdějších předpisů 7 Vymezení hmotného majetku 39 Informace

Více

AMBULANTNÍ PRACOVIŠTĚ

AMBULANTNÍ PRACOVIŠTĚ AMBULANTNÍ PRACOVIŠTĚ Úvod Aktualizovaný seznam ambulancí navazuje na jeho první verzi z roku 2004. Tentokrát jsme jej rozšířili o nové ambulance v připojených nemocnicích Broumov a Opočno, samostatně

Více

Základní pojmy účetnictví neziskových organizací

Základní pojmy účetnictví neziskových organizací Základní pojmy účetnictví neziskových organizací Dagmar Štěpánová Obsah 1. Obecné vztahy spolků a účetnictví.............. 3 2. Vyhláška 504.......................... 4 3. České účetní standardy.....................

Více

Servis 5. Dílenská příručka OCTAVIA II 2004. Motor 1,6/75 kw Vydání 02.04. Servisní služby. Technické informace BGU

Servis 5. Dílenská příručka OCTAVIA II 2004. Motor 1,6/75 kw Vydání 02.04. Servisní služby. Technické informace BGU Servis 5 Dílenská příručka OCTAVIA II 2004 Motor 1,6/75 kw Kód motoru BGU Servisní služby. Technické informace Printed in Czech Republic 5 Servis Toto dílo je autorskoprávně chráněno. Každé použití bez

Více

NÁVOD NA MONTÁŽ, SEŘÍZENÍ A ÚDRŽBU PLASTOVÝCH OKEN A DVEŘÍ

NÁVOD NA MONTÁŽ, SEŘÍZENÍ A ÚDRŽBU PLASTOVÝCH OKEN A DVEŘÍ NÁVOD NA MONTÁŽ, SEŘÍZENÍ A ÚDRŽBU PLASTOVÝCH OKEN A DVEŘÍ Vážený zákazníku, dovolujeme si se na Vás tímto obrátit, abychom Vám poskytli alespoň základní množství důležitých infromací týkajících se montáže,

Více

Dubské slavnosti Z OBSAHU...

Dubské slavnosti Z OBSAHU... zdarma Dubí Mstišov Běhánky Drahůnky Pozorka Bystřice Cínovec Dubské slavnosti Z OBSAHU... Slovo starosty... Z jednání RM... Změny v jízdních řádech... MP informuje... Sběr nebezpečného odpadu... Úklid

Více

Miroslav Dolejší: Analýza událostí 17. listopadu 1989

Miroslav Dolejší: Analýza událostí 17. listopadu 1989 Miroslav Dolejší: Analýza událostí 17. listopadu 1989 I. VÝCHODISKA Tento závěr dokládají tato fakta: Základní myslifikací je tvrzení že, 17. 11. 1989 došlo v Československu ke spontánní revoluci obyvatelstva

Více

ŠKODA Fabia NÁVOD K OBSLUZE

ŠKODA Fabia NÁVOD K OBSLUZE ŠKODA Fabia NÁVOD K OBSLUZE Úvod Rozhodli jste se pro vozidlo Škoda, srdečně Vám děkujeme za Vaši důvěru. S novým vozidlem Škoda získáváte vozidlo s moderní technikou a rozsáhlým vybavením, které budete

Více

TOTAL GYM. Návod k použití. Příručka ke cvičení

TOTAL GYM. Návod k použití. Příručka ke cvičení TOTAL GYM Návod k použití Příručka ke cvičení (V překladu odkazujeme na obrázky v originální anglické příručce EXERCISE BOOKLET dodávané společně se strojem.) Při překladu pro nás byla důležitější srozumitelnost

Více

VIESMANN. Montážní a servisní návod VITOPEND 100-W. pro odborné pracovníky

VIESMANN. Montážní a servisní návod VITOPEND 100-W. pro odborné pracovníky Montážní a servisní návod pro odborné pracovníky VIESMANN Vitopend 100-W Typ WH1B, 10,5 až 24kWa13až 30 kw Plynový nástěnný a kombinovaný kotel pro provoz nezávislý na vzduchu místnosti Provedení na zemní

Více

ŠKODA FELICIA. Opravy a údržba. Jiří Schwarz

ŠKODA FELICIA. Opravy a údržba. Jiří Schwarz Jiří Schwarz ŠKODA FELICIA 99 00 Opravy a údržba OBSAH KNIHY ŠKODA AUTO a. s. A U T O RIZ O VA L A postupy oprav a seřizování svépomocí diagnostika poruch časový a kilometrový plán údržby elektrická schémata

Více

Nastavení internetu. Jak to lze jednoduše, Android

Nastavení internetu. Jak to lze jednoduše, Android internetu Jak to lze jednoduše, Android Jak na to? Mrkněte na mapu pokrytí, jste v místě pokrytí? Máte aktivní datové služby od SAZKAmobil? Zkuste manuální nastavení* Na dalších stránkách najdete jednoduchý

Více

Servis 5. Dílenská příručka OCTAVIA II 2004. Topení, klimatizace Vydání 02.04. Servisní služby. Technické informace

Servis 5. Dílenská příručka OCTAVIA II 2004. Topení, klimatizace Vydání 02.04. Servisní služby. Technické informace Servis 5 Dílenská příručka OCTAVIA II 004 Topení, klimatizace Vydání 0.04 Servisní služby. Technické informace Printed in Czech Republic S00.570.00.5 5 Servis Toto dílo je autorskoprávně chráněno. Každé

Více

Ceník prací na rok 2015

Ceník prací na rok 2015 Ceník prací na rok 2015 Ceník prací HSV i PSV je pouze orientační. Přesnou cenu stanovíme po prohlídce nemovitosti a konzultaci se zákazníkem. Cena, za kterou provádíme jednotlivé práce je závislá i na

Více

Reset servisních intervalů Nastavení parametrů servisních intervalů. SuperVAG OPEN, Brno, 20.1.2016

Reset servisních intervalů Nastavení parametrů servisních intervalů. SuperVAG OPEN, Brno, 20.1.2016 Reset servisních intervalů Nastavení parametrů servisních intervalů SuperVAG OPEN, Brno, 20.1.2016 Osnova Dostupné komfortní funkce účel Typy servisních intervalů Parametry servisních intervalů (podle

Více

Y3 Uživatelská příručka

Y3 Uživatelská příručka Y3 Uživatelská příručka Obsah Nejprve si přečtěte... 1 Bezpečnostní opatření... 1 Osobní údaje a bezpečnost dat... 2 Právní upozornění... 3 Začínáme... 6 Klíčové funkce na dosah ruky... 7 Důležité informace

Více

FORD FOCUS Návod k obsluze pro vlastníky

FORD FOCUS Návod k obsluze pro vlastníky FORD FOCUS Návod k obsluze pro vlastníky Informace, které obsahuje tato publikace, byly v okamžiku předání do tisku správné. Z důvodu dalšího vývoje si kdykoli vyhrazujeme právo na změnu specifikací, designu

Více

Od září vyveze popelnice město

Od září vyveze popelnice město ZPRAVODAJ MĚSTA PLZNĚ ROČNÍK XX Duben 2015 Slavnosti svobody budou letos výjimečné strana 2 Památník Díky, Ameriko! vznikl před 20 lety strana 5 Finále zahájí Staré pověsti české strana 7 Od září vyveze

Více

Martin Herodek. Microsoft Windows 10. Podrobná uživatelská příručka

Martin Herodek. Microsoft Windows 10. Podrobná uživatelská příručka Martin Herodek Microsoft Windows 10 Podrobná uživatelská příručka Computer Press Brno 2015 Microsoft Windows 10 Podrobná uživatelská příručka Martin Herodek Obálka: Martin Sodomka Odpovědný redaktor: Martin

Více

Nařízení 561, 3821 a AETR

Nařízení 561, 3821 a AETR Nařízení 561, 3821 a AETR výtah z dokumentů pro řidiče user 2012 Obsah 1. Předpisy pro práci osádek: Dohoda AETR, nařízení (ES) 561/2006 a (EHS) 3821/85 4 Kdy se použije nařízení 561 a kdy AETR? 4 2. Nařízení

Více

Xiaomi Redmi 3. uživatelská příručka

Xiaomi Redmi 3. uživatelská příručka Xiaomi Redmi 3 uživatelská příručka 2016 Bezpečnostní pokyny a informace Baterie Baterie v modelu Redmi 3 není uživatelsky vyměnitelná. Pokud si přejete baterii vyměnit, kontaktujte servis Xiaomi-Store.cz

Více

AOK-Information für tschechische Grenzgänger und ihre Familienangehörigen

AOK-Information für tschechische Grenzgänger und ihre Familienangehörigen Gesundheit in besten Händen Informace AOK pro české příhraniční pracovníky a jejich rodinné příslušníky AOK-Information für tschechische Grenzgänger und ihre Familienangehörigen Gesundheit in besten Händen

Více

Příručka držitele platební karty. UniCredit Bank Czech Republic and Slovakia, a.s.

Příručka držitele platební karty. UniCredit Bank Czech Republic and Slovakia, a.s. Příručka držitele platební karty UniCredit Bank Czech Republic and Slovakia, a.s. 2 Příručka držitele platební karty UniCredit Bank Czech Republic and Slovakia, a.s. Obsah 1. TYP VAŠÍ KARTY 3 2. PRAKTICKÉ

Více

www.hornbach.cz Zahradní katalog

www.hornbach.cz Zahradní katalog www.hornbach.cz Zahradní katalog rostliny a dekorace 010 Zahradní kalendář Vánoční stromy (i v kontejneru) Advent Dušičky Halloween podzim Podzimní cibuloviny Růže v kontejneru růže růže Velké trvalky

Více

CHYBOVÉ KÓDY KONCERNU VW/ŠKODA

CHYBOVÉ KÓDY KONCERNU VW/ŠKODA CHYBOVÉ KÓDY KONCERNU VW/ŠKODA Dekadický Hexadec Blikací Význam chyby kód chyby kód kód 00000 0000 0000 Nezjištěna závada/konec komunikace 00257 0101 1112 Vstupní ventil ABS PL 00258 0102 1113 Elektromagnetický

Více

Tarif Profi na míru 4 neobsahuje žádné volné datové jednotky, pokud není v Rámcové smlouvě sjednáno jinak.

Tarif Profi na míru 4 neobsahuje žádné volné datové jednotky, pokud není v Rámcové smlouvě sjednáno jinak. Hlasové služby Mobilní hlasové služby Tarify Profi na míru 4 Tarifní program Profi na míru 4 je určen pouze pro zákazníky s Rámcovou smlouvou a nevztahují se na něj žádné položkové množstevní slevy, pokud

Více

Stavebniny speciál HORNBACH AKTUÁLNĚ. Zdící systémy. Stavební chemie. Stavební řezivo. Plotové systémy. Terasy a dlažby. www.hornbach.

Stavebniny speciál HORNBACH AKTUÁLNĚ. Zdící systémy. Stavební chemie. Stavební řezivo. Plotové systémy. Terasy a dlažby. www.hornbach. HORNBACH AKTUÁLNĚ Stavebniny speciál Zdící systéy Přehled sortientu 013 Stavební cheie Stavební řezivo Plotové systéy Terasy a dlažby www.hornbach.cz NYNÍ TAKÉ JAKO ONLINE OBJEDNÁVKA! Tento servis ůžete

Více

Plošné dopravní zklidnění v Praze Karlíně výrazně zvýšilo dopravní nehodovost

Plošné dopravní zklidnění v Praze Karlíně výrazně zvýšilo dopravní nehodovost Ing. Jan Adámek, Ing. Jan Kapitán Technická správa komunikací hlavního města Prahy úsek dopravního inženýrství tel. 724 216 935 email jan.adamek@tskpraha.cz Článek pro konferenci Bezpečná dopravní infrastruktura

Více

PŘESTUPNÍ ŘÁD PRO NEPROFESIONÁLNÍ FOTBALISTY

PŘESTUPNÍ ŘÁD PRO NEPROFESIONÁLNÍ FOTBALISTY PŘESTUPNÍ ŘÁD PRO NEPROFESIONÁLNÍ FOTBALISTY I Základní ustanovení článek 1 1. Tento přestupní řád stanoví podmínky, za nichž se uskutečňují změny klubové příslušnosti amatérských a neamatérských fotbalistů

Více

Servis 5. Dílenská příručka OCTAVIA II 2004. Podvozek Vydání 02.04. Servisní služby. Technické informace. Printed in Czech Republic S00.5703.00.

Servis 5. Dílenská příručka OCTAVIA II 2004. Podvozek Vydání 02.04. Servisní služby. Technické informace. Printed in Czech Republic S00.5703.00. Servis 5 Dílenská příručka OCTAVIA II 004 Podvozek Vydání 0.04 Servisní služby. Technické informace Printed in Czech Republic 5 Servis Toto dílo je autorskoprávně chráněno. Každé použití bez souhlasu autora

Více

APLIKAČNÍ MANUÁL Nopová fólie JUNOP

APLIKAČNÍ MANUÁL Nopová fólie JUNOP APLIKAČNÍ MANUÁL Nopová fólie JUNOP Obsah: 1. Všeobecný popis výrobku... 2 2. Doporučení pro použití... 3 3. Technické parametry... 3 4. Spojování a kotvení... 4 5. Prostupy... 6 6. Klimatické podmínky...

Více

PRAŽSKÁ INTEGROVANÁ DOPRAVA

PRAŽSKÁ INTEGROVANÁ DOPRAVA 9 Možný přestup: Ústí n.l. na příměstskou autobusovou linku PID 72 na přívoz Sedlec Zámky Mělník 11 7 Automat na prodej jednotlivých jízdenek PID: Louny 111 Mladá oleslav Vraňany umístěný v železniční

Více

Základní anglické fráze: Angličtina na cesty

Základní anglické fráze: Angličtina na cesty Základní anglické fráze: Angličtina na cesty Cestování Nápisy Informační kancelář Úschovna zavazadel Ztráty a nálezy Čekárna Jízdenky Zastávka autobusů Autobusová stanice Železniční stanice Stanice metra

Více

002 HACCP Sanitační řád

002 HACCP Sanitační řád Název dokumentu HACCP Sanitační řád Provozovna [zadejte název provozovny] Provozovatel [zadejte firmu] IČ: [zadejte] Vypracoval [zadejte] Datum [datum vytvoření] Schválil [zadejte] Datum [datum schválení]

Více

Směrná účtová osnova s analytickými účty pro příspěvkové organizace

Směrná účtová osnova s analytickými účty pro příspěvkové organizace Směrná účtová osnova s analytickými účty pro příspěvkové organizace Analytické účty jsou doporučené. Pokud má analytický účet vliv na výstup z účetnictví (např. příloha k účetní závěrce), je název sestavy

Více

Maximální hodnoty plnění denního odškodného za dobu léčení úrazu

Maximální hodnoty plnění denního odškodného za dobu léčení úrazu Maximální hodnoty plnění denního odškodného za dobu léčení úrazu Z 0023 (01/2014) Tabulky pro hodnocení úrazového pojištění Maximální hodnoty plnění denního odškodného za dobu léčení úrazu kód 001 529

Více

Cukrárna Globus. Pekárna. Tipy pro nákup čerstvých dortů, zákusků a sladkého pečiva. Sladké pochutnání z vlastní výroby Pekárny Globus.

Cukrárna Globus. Pekárna. Tipy pro nákup čerstvých dortů, zákusků a sladkého pečiva. Sladké pochutnání z vlastní výroby Pekárny Globus. Pekárna Cukrárna Globus Tipy pro nákup čerstvých dortů, zákusků a sladkého pečiva. Sladké pochutnání z vlastní výroby Pekárny Globus. Objednejte si dort nebo zákusky na Vaši oslavu. Máte chuť na sladké?

Více

Úplné znění zákona č. 361/2000 Sb. ke dni 1. červenci 2006

Úplné znění zákona č. 361/2000 Sb. ke dni 1. červenci 2006 Úplné znění zákona č. 361/2000 Sb. ke dni 1. červenci 2006 (změny provedené zákonem č. 411/2005 Sb. jsou v textu vyznačeny tučně) Zákon č. 361/2000 Sb., o provozu na pozemních komunikacích a o změnách

Více

60 dní - Jsme to co jíme - Ing. Petr Havlíček-jídelníček

60 dní - Jsme to co jíme - Ing. Petr Havlíček-jídelníček 60 dní - Jsme to co jíme - Ing. Petr Havlíček-jídelníček POTŘEBNÉ PŘÍSADY chuť a vůle POSTUP PŘÍPRAVY 1.den: Snídaně: 100ml, Čerstvá ovocná, ovocno-zeleninová šťáva, Naředit vodou 2:1 ve prospěch vody

Více

Sopečná činnost a zemětřesení v České republice

Sopečná činnost a zemětřesení v České republice GYMNÁZIUM JAKUBA ŠKODY Ročníková práce z biologie Sopečná činnost a zemětřesení v České republice Václav MACHAČ IV.a, 2004/05 Osek n/b Obsah 1 Úvod... 2 2 Teoretická a metodická část... 3 3 Zemětřesení...

Více

Jak šmakuje Moravskoslezsko

Jak šmakuje Moravskoslezsko Jak šmakuje Moravskoslezsko 2012 Kuchařka krajových receptů Vážení milovníci tradiční kuchyně, dostala se Vám do rukou v pořadí druhá Moravskoslezská kuchařka pod značkou Jak šmakuje Moravskoslezsko. První

Více

ZÁKLADNÍ MONTÁŽNÍ NÁVOD

ZÁKLADNÍ MONTÁŽNÍ NÁVOD ZÁKLADNÍ MONTÁŽNÍ NÁVOD OBECNÉ ZÁSADY Tento montážní návod umožňuje zvládnout pokládku jednoduché střechy. Pro montáž na střechy členité a se složitějšími detaily si vždy vyžádejte bezplatnou konzultaci

Více

50 % sleva 1 + 1 -50 % 1+1 ZDARMA. platnost: Deo Natural Sprejů. Prémiový kupon - 50% na celý sortiment značky. na vybraný sortiment

50 % sleva 1 + 1 -50 % 1+1 ZDARMA. platnost: Deo Natural Sprejů. Prémiový kupon - 50% na celý sortiment značky. na vybraný sortiment 15. platnost: 23. 7. 1. 8. 2015 Skvělé ceny dětského sortimentu uvnitř» 40 dávek 30 dávek Persil prášek, gel 40 dávek, kapsle 30 dávek, * Doporučená cena dodavatele * 1 + 1 libovolná kombinace 359 179

Více

KAMENINOVÉ TROUBY CENÍK 2014-03-01

KAMENINOVÉ TROUBY CENÍK 2014-03-01 KAMENINOVÉ TROUBY CENÍK 2014-03-01 You can t beat quality STEINZEUG KERAMO, s.r.o. Tel.: 387 981 303 Fax: 387 981 487 E-mail: keramo@keramo-kamenina.cz www.keramo-kamenina.cz 2 KOMENTÁŘ Ceník 2014-03-01

Více

Vaše Vodafone Vyúčtování

Vaše Vodafone Vyúčtování Dodavatel: Odběratel: Příjemce: Vodafone Czech Republic a.s. Česká pirátská strana Česká pirátská strana náměstí Junkových 2 Řehořova 943/19 155 00 Praha 5 13000 Praha Řehořova 943/19 Česká republika Česká

Více

PŘIPOJOVACÍ PODMÍNKY NN pro osazení měřicích zařízení v odběrných místech napojených z distribuční sítě nízkého napětí

PŘIPOJOVACÍ PODMÍNKY NN pro osazení měřicích zařízení v odběrných místech napojených z distribuční sítě nízkého napětí PŘIPOJOVACÍ PODMÍNKY NN pro osazení měřicích zařízení v odběrných místech napojených z distribuční sítě nízkého napětí Vydává ČEZ Distribuce, a. s. Platnost od 1. 6. 2015 ČEZ Distribuce, a. s. www.cezdistribuce.cz

Více

Léčebné obstřiky u onemocnění pohybového aparátu

Léčebné obstřiky u onemocnění pohybového aparátu Léčebné obstřiky u onemocnění pohybového aparátu MUDr. Jiří Šramhauser Samostatná ordinace praktického lékaře pro dospělé, Teplice Úvod Obstřiky je možno rozdělit na povrchní k ovlivnění bolesti v reflexních

Více

Používaná anglická přísloví a české ekvivalenty/překlady

Používaná anglická přísloví a české ekvivalenty/překlady A bird in the hand is worth two in the bush. A friend in need is a friend indeed. A man s home is his castle. A rolling stone gathers no moss. A stitch in time saves nine. Actions speak louder than words.

Více

OCEŇOVACÍ TABULKY. pro likvidaci pojistných událostí

OCEŇOVACÍ TABULKY. pro likvidaci pojistných událostí OCEŇOVACÍ TABULKY pro likvidaci pojistných událostí ze samostatného i doplňkového úrazového pojištění a pojištění pro případ pracovní neschopnosti sjednaného v rámci životního pojištění nebo komerčního

Více

NAVRHOVÁNÍ VOZOVEK POZEMNÍCH KOMUNIKACÍ

NAVRHOVÁNÍ VOZOVEK POZEMNÍCH KOMUNIKACÍ MINISTERSTVO DOPRAVY ČESKÉ REPUBLIKY TP 170 NAVRHOVÁNÍ VOZOVEK POZEMNÍCH KOMUNIKACÍ Schváleno MD ČR OPK pod č.j. 517/04-120-RS/1 ze dne 23.11.2004 s účinností od 1. prosince 2004 Současně se ruší a nahrazují

Více

VYSOKÁ ŠKOLA ZDRAVOTNÍCTVA A SOCIÁLNEJ PRÁCE SV. ALŽBETY HOSPIC - SOCIÁLNÍ FENOMÉN MODERNÍ SPOLEČNOSTI

VYSOKÁ ŠKOLA ZDRAVOTNÍCTVA A SOCIÁLNEJ PRÁCE SV. ALŽBETY HOSPIC - SOCIÁLNÍ FENOMÉN MODERNÍ SPOLEČNOSTI VYSOKÁ ŠKOLA ZDRAVOTNÍCTVA A SOCIÁLNEJ PRÁCE SV. ALŽBETY HOSPIC - SOCIÁLNÍ FENOMÉN MODERNÍ SPOLEČNOSTI Rigorózní práce Robert Huneš Bratislava 2008 VYSOKÁ ŠKOLA ZDRAVOTNÍCTVA A SOCIÁLNEJ PRÁCE SV. ALŽBETY

Více

Přehled jízd nostalgických vlaků

Přehled jízd nostalgických vlaků Přehled jízd nostalgických vlaků www.cd.cz/nostalgie VÁŽENÍ PŘÁTELÉ ŽELEZNICE, Tím, že jste otevřeli tento kalendář nostalgických jízd historických vlaků Nostalgie 2015, máte možnost cestovat po železnici

Více

CENÍK ND 2015 PLATNÝ OD 1.2.2015 DO 31.12.2015. CENA 2015 Cena bez DPH. Cena s DPH. Č.položky Název Balení

CENÍK ND 2015 PLATNÝ OD 1.2.2015 DO 31.12.2015. CENA 2015 Cena bez DPH. Cena s DPH. Č.položky Název Balení CENÍK ND 2015 PLATNÝ OD 1.2.2015 DO 31.12.2015 Č.položky Název Balení CENA 2015 Cena bez DPH Cena s DPH 1011314 ŠROUB M6x25 ČSN 021151.25 1 1,35 1,63 1012570 ŠROUB M6x6 ČSN 021103.55 1 2,41 2,92 1300516

Více

BE-ON-ROAD UŽIVATELSKÁ PŘÍRUČKA

BE-ON-ROAD UŽIVATELSKÁ PŘÍRUČKA BE-ON-ROAD UŽIVATELSKÁ PŘÍRUČKA i 1. SYSTÉMOVÉ POŽADAVKY... 4 1.1. PODPOROVANÉ OPERAČNÍ SYSTÉMY... 4 1.2. POŽADAVKY NA HARDWARE... 4 2. INSTALACE... 5 2.1. INSTALACE PŘES BE-ON-ROAD WIZARD... 5 2.2. INSTALACE

Více

Neurologické příznaky stenózy páteřního kanálu. MUDr. Denisa Šímová Neurologické oddělení Krajská nemocnice Liberec, a.s.

Neurologické příznaky stenózy páteřního kanálu. MUDr. Denisa Šímová Neurologické oddělení Krajská nemocnice Liberec, a.s. Neurologické příznaky stenózy páteřního kanálu MUDr. Denisa Šímová Neurologické oddělení Krajská nemocnice Liberec, a.s. Definice : Zúžení páteřního kanálu na základě postižení kostí, měkkých tkání či

Více

Naučné středisko ekologické výchovy Kladno Čabárna obecně prospěšná společnost

Naučné středisko ekologické výchovy Kladno Čabárna obecně prospěšná společnost Obsah 1. Organizace 2. Spolupráce se Středočeským krajem 3. Investice do rozvoje vzdělávání 4. EVVO pro školská zařízení 5. Mimoškolní činnosti 6. Akce pro veřejnost 7. Soutěţe 8. Odborné akce, semináře

Více

Welfare v drobnochovech a velkochovech drůbeže

Welfare v drobnochovech a velkochovech drůbeže Welfare v drobnochovech a velkochovech drůbeže Klinika chorob ptáků, plazů a drobných savců Stavy nosnic a produkce konzumních vajec v roce 2011 Stavy nosnic a produkce konzumních vajec v roce 2012 Měřicí

Více

Zákon č. 561/2004 Sb., ČÁST PRVNÍ

Zákon č. 561/2004 Sb., ČÁST PRVNÍ Zákon č. 561/2004 Sb., o předškolním, základním, středním, vyšším odborném a jiném vzdělávání (školský zákon), ve znění zákona č. 383/2005 Sb., č. 112/2006 Sb., č. 158/2006 Sb., č. 161/2006 Sb., č. 165/2006

Více

Seismická aktivita v ČR

Seismická aktivita v ČR Endogenní reliéf podmíněný endogenními procesy: tektonika, sopečnáčinnost, zemětřesení historicky významné: přelom 2H/3H aktivní sopečnáčinnost (sopečný reliéf) tektonika rozlámání ker, pohyby podél zlomů

Více

pro nového zaměstnance Dopravního podniku hl. m. Prahy, akciové společnosti

pro nového zaměstnance Dopravního podniku hl. m. Prahy, akciové společnosti Praktické informace pro nového zaměstnance Dopravního podniku hl. m. Prahy, akciové společnosti Obsah: www.dpp.cz Dopravní podnik zaměstnancům Na úvod 3 O Dopravním podniku 4 TOP management DPP 5 Z historie

Více

Uživatelská příručka. Sygic GPS Navigation. v3 (Mobile) 2011 Sygic, a.s. Všechna práva vyhrazena.

Uživatelská příručka. Sygic GPS Navigation. v3 (Mobile) 2011 Sygic, a.s. Všechna práva vyhrazena. Uživatelská příručka Sygic GPS Navigation v3 (Mobile) 2011 Sygic, a.s. Všechna práva vyhrazena. I. Začínáme...2 Zadávání adresy...4 Turn by Turn navigace...8 Vyhledávání GPS pozice...9 II. Plánování trasy...

Více

UŽIVATELSKÁ PŘÍRUČKA. Kabelový modem COMPAL řady CH7465LG s bezdrátovou technologií

UŽIVATELSKÁ PŘÍRUČKA. Kabelový modem COMPAL řady CH7465LG s bezdrátovou technologií UŽIVATELSKÁ PŘÍRUČKA Kabelový modem COMPAL řady CH7465LG s bezdrátovou technologií Obsah Přehled... 4 Kontaktní informace... 4 Standardní funkce... 4 Volby zařízení CH7465LG LAN... 5 Bezdrátová síť LAN...

Více

ADRESÁŘ ROZHODČÍCH OFS BRNO VENKOV

ADRESÁŘ ROZHODČÍCH OFS BRNO VENKOV ADRESÁŘ ROZHODČÍCH OFS BRNO VENKOV 2012/2013 podzim Rozhodčí na nominační listině OFS Brno-venkov Příjmení a jméno Albrecht Jiří 5.7.1950 50070098 Ivančice, Pod Hájkem 88/85 604 781 886 albrecht.jiri@volny.cz

Více

POKYNY. k vyplnění Přiznání k dani z nabytí nemovitých věcí

POKYNY. k vyplnění Přiznání k dani z nabytí nemovitých věcí POKYNY k vyplnění Přiznání k dani z nabytí nemovitých věcí podle zákonného opatření Senátu č. 340/2013 Sb., o dani z nabytí nemovitých věcí (dále jen zákonné opatření ) Tiskopis daňového přiznání (dále

Více

6 Bezpečnost online systémů a platebních systémů

6 Bezpečnost online systémů a platebních systémů 6 Bezpečnost online systémů a platebních systémů Cíle výuky modulu Popsat klíčové aspekty bezpečnosti e-commerce Identifikovat klíčové bezpečnostní hrozby v prostředí e-commerce. Popsat, jak technologie

Více

Sešit pro laboratorní práci z chemie

Sešit pro laboratorní práci z chemie Sešit pro laboratorní práci z chemie téma: Bezpečnost a hygiena práce v chemické školní laboratoři autor: MVDr. Alexandra Gajová vytvořeno při realizaci projektu: Inovace školního vzdělávacího programu

Více

Service 80. Vznětové motory 1,2; 1,6 l a 2,0 l. Dílenská učební pomůcka. se systémem vstřikování common rail

Service 80. Vznětové motory 1,2; 1,6 l a 2,0 l. Dílenská učební pomůcka. se systémem vstřikování common rail Service 80 Vznětové motory 1,2; 1,6 l a 2,0 l se systémem vstřikování common rail Dílenská učební pomůcka Obsah Stručný popis motorů 4 Mechanická část motoru 6 7 9 11 12 14 17 19 25 29 Systém řízení motoru

Více

MALÝ PRŮVODCE ÚZEMNÍM A STAVEBNÍM ŘÍZENÍM

MALÝ PRŮVODCE ÚZEMNÍM A STAVEBNÍM ŘÍZENÍM I Vážení přátelé, mám hned několik dobrých důvodů k tomu, abych Vám doporučil tuto užitečnou příručku. Předně jde v pravém slova smyslu o příručku, tedy o užitečnou pomůcku, kterou se vyplatí mít při ruce,

Více

CITROËN C3 Návod k obsluze

CITROËN C3 Návod k obsluze CITROËN C3 Návod k obsluze Tento návod byl sestaven na základě technické výbavy vozidla (sériové nebo volitelné) a technických charakteristik známých v době vytvoření. Úroveň výbavy Vašeho vozidla závisí

Více

B310 LTE CPE Stručný návod

B310 LTE CPE Stručný návod B310 LTE CPE Stručný návod 3150XXXX_01 1 Seznámení s vaším B310 Indikátor napájení Indikátor síťového režimu Indikátor Wi-Fi / WPS Zap: B310 je zapnutý. Vyp: B310 je vypnutý. Trvale svítí azurová: připojeno

Více

Západočeská univerzita v Plzni Fakulta aplikovaných věd Katedra informatiky a výpočetní techniky. v EEG/ERP portálu

Západočeská univerzita v Plzni Fakulta aplikovaných věd Katedra informatiky a výpočetní techniky. v EEG/ERP portálu Západočeská univerzita v Plzni Fakulta aplikovaných věd Katedra informatiky a výpočetní techniky Diplomová práce Systém oprávnění v EEG/ERP portálu Plzeň, 2011 Jiří Vlašimský Prohlášení Prohlašuji, že

Více

Zkus být elektrikářem

Zkus být elektrikářem Zkus být elektrikářem I. Zásuvkový obvod - zjednodušený Komentář: Zásuvkové obvody se zřizují pro připojení spotřebičů vidlicí do zásuvky. Na zásuvkové obvody lze podle potřeby pevně připojit jednoúčelové

Více

Uživatelská příručka. Porto (E560)

Uživatelská příručka. Porto (E560) Uživatelská příručka Porto (E560) CZ ZPRÁVA OD COOLPADU Děkujeme vám, že jste si zakoupili mobilní telefon Porto E560! Postupujte prosím podle těchto jednoduchých - avšak důležitých - pokynů pro optimální

Více

LITOMĚŘICE TEMATEM DISKUSE BUDE TRŽNICE

LITOMĚŘICE TEMATEM DISKUSE BUDE TRŽNICE LITOMĚŘICE SLOVO STAROSTY Litoměřice realizují řadu projektů, kterými dávají najevo, že Zdravým a Fairtradovým městem nejsou náhodou. Proto mě potěšila slova ministra zahraničí Lubomíra Zaorálka, který

Více

Technologický předpis pro odborné provedení ETICS

Technologický předpis pro odborné provedení ETICS Technologický předpis pro odborné provedení ETICS P Podmínky použití kontaktního zateplovacího systému musí být v souladu s projektovou dokumentací pro provedení systému, jejíž součástí je i výběr systému

Více

Operačnívýkony v gynekologii a porodnictví

Operačnívýkony v gynekologii a porodnictví Operačnívýkony v gynekologii a porodnictví As. MUDr. Martin Petrenko Gynekol. - porod. klinika MU a FN Brno přednosta prof. MUDr. Ventruba, CSc. Operační gynekologie- obecný úvod Vyčlenění z chirurgie

Více

Jak se stravovat při diabetu 2. typu

Jak se stravovat při diabetu 2. typu Jak se stravovat při diabetu 2. typu Diabetes mellitus Diabetes mellitus (cukrovka) je metabolická porucha, projevující se zvýšenou hladinou cukru v krvi. Jde o onemocnění, při kterém je relativní nebo

Více

AUKCE ČESKÉHO A SVĚTOVÉHO VÝTVARNÉHO UMĚNÍ

AUKCE ČESKÉHO A SVĚTOVÉHO VÝTVARNÉHO UMĚNÍ AUKCE ČESKÉHO A SVĚTOVÉHO VÝTVARNÉHO UMĚNÍ S MIMOŘÁDNOU KOLEKCÍ Z ATELIERU KARLA HOLANA A SOUBOREM NĚMECKY MLUVÍCÍCH AUTORŮ Z ÚZEMÍ ČR A KOLEKCÍ HERTY PRYMUSOVÉ-STACHOVÉ Středa, 7. 10. 2015 v 17.30 hod.

Více

Třífázový statický ELEktroměr

Třífázový statický ELEktroměr Třífázový statický ELEktroměr ZE 312 Elektroměr ZE312.Dx je třífázový jedno nebo dvoutarifní elektroměr určený pro měření spotřeby elektrické energie v obytných a obchodních prostorách a v lehkém průmyslu.

Více

Autorizovaný záruční a pozáruční servis kávovárů:

Autorizovaný záruční a pozáruční servis kávovárů: Autorizovaný záruční a pozáruční servis kávovárů: CAFFE SERVIS - specializovaný obchod adresa: 28. října 248, 709 00, Ostrava - Mariánské Hory zapůjčení kávovaru (po dobu opravy) - vč.dph: 60 Kč/den tel:

Více

Příloha Zahraničí k žádosti o německé přídavky na dítě ze dne.. Anlage Ausland zum Antrag auf deutsches Kindergeld vom

Příloha Zahraničí k žádosti o německé přídavky na dítě ze dne.. Anlage Ausland zum Antrag auf deutsches Kindergeld vom Příjmení a jméno žadatele Name und Vorname der antragstellenden Person č. přídavku na dítě. Kindergeld-Nr. F K Příloha Zahraničí k žádosti o německé přídavky na dítě ze dne.. Anlage Ausland zum Antrag

Více

OVB Journal. Next level Po dvaceti letech své existence je české OVB na úplně jiné úrovni a míří dál

OVB Journal. Next level Po dvaceti letech své existence je české OVB na úplně jiné úrovni a míří dál OVB Journal duben 2013 Next level Po dvaceti letech své existence je české OVB na úplně jiné úrovni a míří dál LD Petr Saic Splnil si sen vlastního zemského ředitelství, ale usiluje o dalších úspěchy LD

Více

ØD 1 mm. Ød mm. Ød 1 m

ØD 1 mm. Ød mm. Ød 1 m 4 Trny pro vrtačková sklíčidla Arbors for drill chucks Aufnahmedorne für Bohrfutter ČSN 241329 Order number Bezeichnung Nuer Stopka Shank Schaft ČSN 220444 Přiřazená stopka MORSE Attached MORSE Shank Zugeordnete

Více

Sdělení. pro vyvěšení na úřední desce soudního exekutora dle 49 odst. 4 o.s.ř.

Sdělení. pro vyvěšení na úřední desce soudního exekutora dle 49 odst. 4 o.s.ř. EX 100/09 POLS s.r.o. IČ: Nerudova 1064 Kralupy nad Vltavou EX 100/09-262 usnesení - nový termín dražby 25111752 EX 8054/09 Andrejsová Věra 11.03.1970 5. května 1272 Kladno EX 8054/09-41 usn. - změna plátce

Více

SYNCHRONNÍ MOTOR. Konstrukce

SYNCHRONNÍ MOTOR. Konstrukce SYNCHRONNÍ MOTOR Konstrukce A. stator synchronního motoru má stejnou konstrukci jako stator asynchronního motoru na svazku statorových plechů je uloženo trojfázové vinutí, potřebné k vytvoření točivého

Více

ELEKTROKOLOBĚŽKA (koloběžka s pomocným motorem) HUGO Bike. Typ 008 PRO

ELEKTROKOLOBĚŽKA (koloběžka s pomocným motorem) HUGO Bike. Typ 008 PRO ELEKTROKOLOBĚŽKA (koloběžka s pomocným motorem) HUGO Bike Typ 008 PRO Gratulujeme Vám k nákupu luxusní elektrokoloběžky HUGO Bike, která Vám dopřeje nevšední zážitek zdoláváním velkých dávek kilometrů

Více

Provozní řád školní kuchyně

Provozní řád školní kuchyně 1 Vnitřní směrnice Základní školy a Mateřské školy Bezměrov Provozní řád školní kuchyně Sp.sk.:. A10 V Bezměrově 23.srpna 2013 Působnost Všichni zaměstnanci školy Zpracoval: Mgr. Alena Botková Účinnost

Více

OBYTNÝ MINIKARAVAN RESIDENTAL MINICARAVAN

OBYTNÝ MINIKARAVAN RESIDENTAL MINICARAVAN VYSOKÉ UČENÍ TECHNICKÉ V BRNĚ BRNO UNIVERSITY OF TECHNOLOGY FAKULTA STROJNÍHO INŽENÝRSTVÍ ÚSTAV KONSTRUOVÁNÍ FACULTY OF MECHANICAL ENGINEERING INSTITUTE OF MACHINE AND INDUSTRIAL DESIGN OBYTNÝ MINIKARAVAN

Více

Obsah. orientační cena : 5500,- Kč. Řídící jednotky motoru. Řídící jednotky ABS. Váha - průtokoměr vzduchu. orientační cena : 4500-5500,- Kč

Obsah. orientační cena : 5500,- Kč. Řídící jednotky motoru. Řídící jednotky ABS. Váha - průtokoměr vzduchu. orientační cena : 4500-5500,- Kč KATALOG Řídící jednotky Řídící jednotky ABS Váhy vzduchu Průtokoměry vzduchu Škrtící klapky Kombinované přístroje Displej, klima, rádia Navigační systémy Rozdělovače Obsah Ceny jsou uvedeny bez DPH Řídící

Více

Medicínská latina I.

Medicínská latina I. Medicínská latina I. pro studentky a studenty ZSF JU (pracovní text) Zdeněk Žalud Ondřej Doskočil 2015 I. lekce: slovotvorba a deklinace substantiv, adjektiva 1. a 2. dekl. Všimněte si, jak vypadají názvy

Více

TECHNICKÁ DOKUMENTACE

TECHNICKÁ DOKUMENTACE VŠB-TU Ostrava, Fakulta elektrotechniky a informatiky Katedra elektrických strojů a přístrojů KAT 453 TECHNICKÁ DOKUMENTACE (přednášky pro hodiny cvičení) Zobrazování Petr Šňupárek, Martin Marek 1 Co je

Více

ADRESY KALMETIZACÍ V ČESKÉ REPUBLICE

ADRESY KALMETIZACÍ V ČESKÉ REPUBLICE ADRESY KALMETIZACÍ V ČESKÉ REPUBLICE AŠ - ZRUŠENO = Cheb BENEŠOV u Prahy - Plicní a interna s.r.o., Žižkova 418, PSČ 256 01, tel: 317 724 044, s. Roubíčková jitka.chrastany@seznam.cz BEROUN - Medicentrum

Více

Uživatelská příručka

Uživatelská příručka VMG1312-B30B Čtyřportová brána VDSL2 s bezdrátovou technologií 802.11n Uživatelská příručka IP Adresa Přihlašovací jméno Heslo http://10.0.0.138 admin admin 3/2014 www.zyxel.com Zařízení ZyXEL VMG1312-B30B

Více

Novela školského zákona

Novela školského zákona Novela školského zákona V únoru 2015 Poslanecká sněmovna schválila návrh novely školského zákona a některých dalších zákonů (zákona o poskytování dotací soukromým školám, předškolním a školským zařízením,

Více

SPORTOVNĚ REKREAČNÍ AREÁL VRCHBĚLÁ MULTIFUNKČNÍ TURISTICKÉ CENTRUM

SPORTOVNĚ REKREAČNÍ AREÁL VRCHBĚLÁ MULTIFUNKČNÍ TURISTICKÉ CENTRUM Sídlo: Doudova 544/11, 147 00 Praha 4 Podolí Provozovna: Masarykova 62/109, 400 01 Ústí nad Labem IČ: 25423363, DIČ: CZ25423363 Název akce: SPORTOVNĚ REKREAČNÍ AREÁL VRCHBĚLÁ MULTIFUNKČNÍ TURISTICKÉ CENTRUM

Více

Schémata elektrických obvodů

Schémata elektrických obvodů Schémata elektrických obvodů Schémata elektrických obvodů Číslo linie napájení Elektrický obvod 30 Propojení s kladným pólem akumulátorové baterie 31 Kostra 15, 15a Propojení s kladným pólem akumulátorové

Více

Lenovo. Uživatelská příručka. Před používáním počítače si přečtěte bezpečnostní upozornění a důležité rady v dodaných příručkách.

Lenovo. Uživatelská příručka. Před používáním počítače si přečtěte bezpečnostní upozornění a důležité rady v dodaných příručkách. Lenovo Uživatelská příručka Před používáním počítače si přečtěte bezpečnostní upozornění a důležité rady v dodaných příručkách. Poznámky Před používáním výrobku si přečtěte Příručka s bezpečnostními a

Více

Plošné dopravní zklidnění v Praze Karlíně výrazně zvýšilo dopravní nehodovost

Plošné dopravní zklidnění v Praze Karlíně výrazně zvýšilo dopravní nehodovost Ing. Jan Adámek, Ing. Jan Kapitán Technická správa komunikací hlavního města Prahy úsek dopravního inženýrství tel. 724 216 935 email jan.adamek@tskpraha.cz Článek pro konferenci Bezpečná dopravní infrastruktura

Více

ŠKODA FELICIA. Opravy a údržba. Jiří Schwarz

ŠKODA FELICIA. Opravy a údržba. Jiří Schwarz Jiří Schwarz ŠKODA FELICIA 99 00 Opravy a údržba OBSAH KNIHY ŠKODA AUTO a. s. A U T O RIZ O VA L A postupy oprav a seřizování svépomocí diagnostika poruch časový a kilometrový plán údržby elektrická schémata

Více

Pravidla pro používání Klientské zóny České pojišťovny a.s.

Pravidla pro používání Klientské zóny České pojišťovny a.s. Pravidla pro používání Klientské zóny České pojišťovny a.s. I. Úvodní ustanovení 1. Klientskou zónou České pojišťovny a.s. (dále též KZ ) se rozumí aplikace dostupná na internetových stránkách České pojišťovny

Více

Y3 Uživatelská příručka

Y3 Uživatelská příručka Y3 Uživatelská příručka Obsah Nejprve si přečtěte... 1 Bezpečnostní opatření... 1 Osobní údaje a bezpečnost dat... 2 Právní upozornění... 3 Začínáme... 6 Klíčové funkce na dosah ruky... 7 Důležité informace

Více

Základní pojmy účetnictví neziskových organizací

Základní pojmy účetnictví neziskových organizací Základní pojmy účetnictví neziskových organizací Dagmar Štěpánová Obsah 1. Obecné vztahy spolků a účetnictví.............. 3 2. Vyhláška 504.......................... 4 3. České účetní standardy.....................

Více

Návod pro uživatele DS150E. Dangerfield May 2009 V3.0 Delphi PSS

Návod pro uživatele DS150E. Dangerfield May 2009 V3.0 Delphi PSS Návod pro uživatele DS150E 1 OBSAH Hlavní součásti...3 Zápis do elektronické řídicí jednotky (OBD)...86 Pokyny k instalaci......5 Skenování... 89 Konfigurace technologie Bluetooth...26 Diagnostický program...39

Více

Nastavení internetu. Jak to lze jednoduše, Android

Nastavení internetu. Jak to lze jednoduše, Android internetu Jak to lze jednoduše, Android Jak na to? Mrkněte na mapu pokrytí, jste v místě pokrytí? Máte aktivní datové služby od SAZKAmobil? Zkuste manuální nastavení* Na dalších stránkách najdete jednoduchý

Více

ŠKODA Fabia NÁVOD K OBSLUZE

ŠKODA Fabia NÁVOD K OBSLUZE ŠKODA Fabia NÁVOD K OBSLUZE Úvod Rozhodli jste se pro vozidlo Škoda, srdečně Vám děkujeme za Vaši důvěru. S novým vozidlem Škoda získáváte vozidlo s moderní technikou a rozsáhlým vybavením, které budete

Více

60 dní - Jsme to co jíme - Ing. Petr Havlíček-jídelníček

60 dní - Jsme to co jíme - Ing. Petr Havlíček-jídelníček 60 dní - Jsme to co jíme - Ing. Petr Havlíček-jídelníček POTŘEBNÉ PŘÍSADY chuť a vůle POSTUP PŘÍPRAVY 1.den: Snídaně: 100ml, Čerstvá ovocná, ovocno-zeleninová šťáva, Naředit vodou 2:1 ve prospěch vody

Více

VIESMANN. Montážní a servisní návod VITOPEND 100-W. pro odborné pracovníky

VIESMANN. Montážní a servisní návod VITOPEND 100-W. pro odborné pracovníky Montážní a servisní návod pro odborné pracovníky VIESMANN Vitopend 100-W Typ WH1B, 10,5 až 24kWa13až 30 kw Plynový nástěnný a kombinovaný kotel pro provoz nezávislý na vzduchu místnosti Provedení na zemní

Více

CHYBOVÉ KÓDY KONCERNU VW/ŠKODA

CHYBOVÉ KÓDY KONCERNU VW/ŠKODA CHYBOVÉ KÓDY KONCERNU VW/ŠKODA Dekadický Hexadec Blikací Význam chyby kód chyby kód kód 00000 0000 0000 Nezjištěna závada/konec komunikace 00257 0101 1112 Vstupní ventil ABS PL 00258 0102 1113 Elektromagnetický

Více

OCEŇOVACÍ TABULKY. pro likvidaci pojistných událostí

OCEŇOVACÍ TABULKY. pro likvidaci pojistných událostí OCEŇOVACÍ TABULKY pro likvidaci pojistných událostí ze samostatného i doplňkového úrazového pojištění a pojištění pro případ pracovní neschopnosti sjednaného v rámci životního pojištění nebo komerčního

Více

Navigátor pro Android Manuál. 2015... MapFactor s.r.o.

Navigátor pro Android Manuál. 2015... MapFactor s.r.o. Navigátor pro Android Manuál I Navigator pro Android Obsah 0 Část I Úvod 4 Část II Instalace Navigátoru 6 1 Instalace aplikace... Navigátor 6 2 Instalace map... 7 Část III Práce s Navigátorem 14 1 Zadání

Více

Ceník prací na rok 2015

Ceník prací na rok 2015 Ceník prací na rok 2015 Ceník prací HSV i PSV je pouze orientační. Přesnou cenu stanovíme po prohlídce nemovitosti a konzultaci se zákazníkem. Cena, za kterou provádíme jednotlivé práce je závislá i na

Více

NÁVOD NA MONTÁŽ, SEŘÍZENÍ A ÚDRŽBU PLASTOVÝCH OKEN A DVEŘÍ

NÁVOD NA MONTÁŽ, SEŘÍZENÍ A ÚDRŽBU PLASTOVÝCH OKEN A DVEŘÍ NÁVOD NA MONTÁŽ, SEŘÍZENÍ A ÚDRŽBU PLASTOVÝCH OKEN A DVEŘÍ Vážený zákazníku, dovolujeme si se na Vás tímto obrátit, abychom Vám poskytli alespoň základní množství důležitých infromací týkajících se montáže,

Více

Servis 5. Dílenská příručka OCTAVIA II 2004. Topení, klimatizace Vydání 02.04. Servisní služby. Technické informace

Servis 5. Dílenská příručka OCTAVIA II 2004. Topení, klimatizace Vydání 02.04. Servisní služby. Technické informace Servis 5 Dílenská příručka OCTAVIA II 004 Topení, klimatizace Vydání 0.04 Servisní služby. Technické informace Printed in Czech Republic S00.570.00.5 5 Servis Toto dílo je autorskoprávně chráněno. Každé

Více

50 % sleva 1 + 1 -50 % 1+1 ZDARMA. platnost: Deo Natural Sprejů. Prémiový kupon - 50% na celý sortiment značky. na vybraný sortiment

50 % sleva 1 + 1 -50 % 1+1 ZDARMA. platnost: Deo Natural Sprejů. Prémiový kupon - 50% na celý sortiment značky. na vybraný sortiment 15. platnost: 23. 7. 1. 8. 2015 Skvělé ceny dětského sortimentu uvnitř» 40 dávek 30 dávek Persil prášek, gel 40 dávek, kapsle 30 dávek, * Doporučená cena dodavatele * 1 + 1 libovolná kombinace 359 179

Více

Drobný hmotný majetek

Drobný hmotný majetek DLOUHODOBÝ HMOTNÝ MAJETEK DLO str. 1 HESLA MAJÍ PEVNĚ STANOVENOU STRUKTURU Drobný hmotný majetek Právní úprava: Vyhláška č. 500/2002 Sb., ve znění pozdějších předpisů 7 Vymezení hmotného majetku 39 Informace

Více

www.hornbach.cz Zahradní katalog

www.hornbach.cz Zahradní katalog www.hornbach.cz Zahradní katalog rostliny a dekorace 010 Zahradní kalendář Vánoční stromy (i v kontejneru) Advent Dušičky Halloween podzim Podzimní cibuloviny Růže v kontejneru růže růže Velké trvalky

Více

TOTAL GYM. Návod k použití. Příručka ke cvičení

TOTAL GYM. Návod k použití. Příručka ke cvičení TOTAL GYM Návod k použití Příručka ke cvičení (V překladu odkazujeme na obrázky v originální anglické příručce EXERCISE BOOKLET dodávané společně se strojem.) Při překladu pro nás byla důležitější srozumitelnost

Více

JAK ZAČÍT S SCD PĚT FÁZÍ POSTUPU

JAK ZAČÍT S SCD PĚT FÁZÍ POSTUPU JAK ZAČÍT S SCD JAK ZAČÍT S SCD PĚT FÁZÍ POSTUPU ÚVOD ÚVOD Představujeme vám plán postupu nasazování potravin při SCD. Je skvělou pomůckou při zavádění této výživy. Tělo přechází na zcela nový režim a

Více

Servis 5. Dílenská příručka OCTAVIA II 2004. Podvozek Vydání 02.04. Servisní služby. Technické informace. Printed in Czech Republic S00.5703.00.

Servis 5. Dílenská příručka OCTAVIA II 2004. Podvozek Vydání 02.04. Servisní služby. Technické informace. Printed in Czech Republic S00.5703.00. Servis 5 Dílenská příručka OCTAVIA II 004 Podvozek Vydání 0.04 Servisní služby. Technické informace Printed in Czech Republic 5 Servis Toto dílo je autorskoprávně chráněno. Každé použití bez souhlasu autora

Více

B310 LTE CPE Stručný návod

B310 LTE CPE Stručný návod B310 LTE CPE Stručný návod 3150XXXX_01 1 Seznámení s vaším B310 Indikátor napájení Indikátor síťového režimu Indikátor Wi-Fi / WPS Zap: B310 je zapnutý. Vyp: B310 je vypnutý. Trvale svítí azurová: připojeno

Více

Zkus být elektrikářem

Zkus být elektrikářem Zkus být elektrikářem I. Zásuvkový obvod - zjednodušený Komentář: Zásuvkové obvody se zřizují pro připojení spotřebičů vidlicí do zásuvky. Na zásuvkové obvody lze podle potřeby pevně připojit jednoúčelové

Více

Jak přežít ekonomický kolaps poučení z Argentiny

Jak přežít ekonomický kolaps poučení z Argentiny Jak přežít ekonomický kolaps poučení z Argentiny Prosíme o šíření textu, ať už odkazem na článek, nebo e-mailem jako přílohu. Děkujeme! Zdroj: http://www.freepub.cz/2012/jak-prezit-ekonomicky-kolaps/ Osnova:

Více

ZÁKLADNÍ MONTÁŽNÍ NÁVOD

ZÁKLADNÍ MONTÁŽNÍ NÁVOD ZÁKLADNÍ MONTÁŽNÍ NÁVOD OBECNÉ ZÁSADY Tento montážní návod umožňuje zvládnout pokládku jednoduché střechy. Pro montáž na střechy členité a se složitějšími detaily si vždy vyžádejte bezplatnou konzultaci

Více

VYTVOŘENÍ ÚČTU LG SMART WORLD

VYTVOŘENÍ ÚČTU LG SMART WORLD VYTVOŘENÍ ÚČTU LG SMART WORLD Přihlášení a Registrace Copyright 2012 LG Electronics. All Rights Reserved. 01. Stlačením tlačítka Home na dálkovém ovladači spustíte úvodní obrazovku LG Smart TV. 01A. V

Více

Sodexo Cafeteria MojeBenefity

Sodexo Cafeteria MojeBenefity 2 V TOMTO ČÍSLE: Cafeteria MojeBenefity od Sodexo Vánoční bonus Sbírejte a recyklujte s námi Listopad = měsíc kvality Safety first, aneb dbejte své osobní bezpečnosti Tokio - město, které nikdy nespí Kalendář

Více

Cukrárna Globus. Pekárna. Tipy pro nákup čerstvých dortů, zákusků a sladkého pečiva. Sladké pochutnání z vlastní výroby Pekárny Globus.

Cukrárna Globus. Pekárna. Tipy pro nákup čerstvých dortů, zákusků a sladkého pečiva. Sladké pochutnání z vlastní výroby Pekárny Globus. Pekárna Cukrárna Globus Tipy pro nákup čerstvých dortů, zákusků a sladkého pečiva. Sladké pochutnání z vlastní výroby Pekárny Globus. Objednejte si dort nebo zákusky na Vaši oslavu. Máte chuť na sladké?

Více

Nařízení 561, 3821 a AETR

Nařízení 561, 3821 a AETR Nařízení 561, 3821 a AETR výtah z dokumentů pro řidiče user 2012 Obsah 1. Předpisy pro práci osádek: Dohoda AETR, nařízení (ES) 561/2006 a (EHS) 3821/85 4 Kdy se použije nařízení 561 a kdy AETR? 4 2. Nařízení

Více

Jak šmakuje Moravskoslezsko

Jak šmakuje Moravskoslezsko Jak šmakuje Moravskoslezsko 2012 Kuchařka krajových receptů Vážení milovníci tradiční kuchyně, dostala se Vám do rukou v pořadí druhá Moravskoslezská kuchařka pod značkou Jak šmakuje Moravskoslezsko. První

Více

Xiaomi Redmi 3. uživatelská příručka

Xiaomi Redmi 3. uživatelská příručka Xiaomi Redmi 3 uživatelská příručka 2016 Bezpečnostní pokyny a informace Baterie Baterie v modelu Redmi 3 není uživatelsky vyměnitelná. Pokud si přejete baterii vyměnit, kontaktujte servis Xiaomi-Store.cz

Více

Léčebné obstřiky u onemocnění pohybového aparátu

Léčebné obstřiky u onemocnění pohybového aparátu Léčebné obstřiky u onemocnění pohybového aparátu MUDr. Jiří Šramhauser Samostatná ordinace praktického lékaře pro dospělé, Teplice Úvod Obstřiky je možno rozdělit na povrchní k ovlivnění bolesti v reflexních

Více

Servis 5. Dílenská příručka OCTAVIA II 2004. Motor 1,6/75 kw Vydání 02.04. Servisní služby. Technické informace BGU

Servis 5. Dílenská příručka OCTAVIA II 2004. Motor 1,6/75 kw Vydání 02.04. Servisní služby. Technické informace BGU Servis 5 Dílenská příručka OCTAVIA II 2004 Motor 1,6/75 kw Kód motoru BGU Servisní služby. Technické informace Printed in Czech Republic 5 Servis Toto dílo je autorskoprávně chráněno. Každé použití bez

Více

Uživatelská příručka. Sygic GPS Navigation. v3 (Mobile) 2011 Sygic, a.s. Všechna práva vyhrazena.

Uživatelská příručka. Sygic GPS Navigation. v3 (Mobile) 2011 Sygic, a.s. Všechna práva vyhrazena. Uživatelská příručka Sygic GPS Navigation v3 (Mobile) 2011 Sygic, a.s. Všechna práva vyhrazena. I. Začínáme...2 Zadávání adresy...4 Turn by Turn navigace...8 Vyhledávání GPS pozice...9 II. Plánování trasy...

Více

fēnix 3 Návod k obsluze

fēnix 3 Návod k obsluze fēnix 3 Návod k obsluze Leden 2015 Vytištěno na Tchaj-wanu 190-01840-41_0A Všechna práva vyhrazena. Na základě autorských zákonů není povoleno tento návod kopírovat (jako celek ani žádnou jeho část) bez

Více

Uživatelská příručka

Uživatelská příručka VMG1312-B30B Čtyřportová brána VDSL2 s bezdrátovou technologií 802.11n Uživatelská příručka IP Adresa Přihlašovací jméno Heslo http://10.0.0.138 admin admin 3/2014 www.zyxel.com Zařízení ZyXEL VMG1312-B30B

Více

AMBULANTNÍ PRACOVIŠTĚ

AMBULANTNÍ PRACOVIŠTĚ AMBULANTNÍ PRACOVIŠTĚ Úvod Aktualizovaný seznam ambulancí navazuje na jeho první verzi z roku 2004. Tentokrát jsme jej rozšířili o nové ambulance v připojených nemocnicích Broumov a Opočno, samostatně

Více

Obsah. orientační cena : 5500,- Kč. Řídící jednotky motoru. Řídící jednotky ABS. Váha - průtokoměr vzduchu. orientační cena : 4500-5500,- Kč

Obsah. orientační cena : 5500,- Kč. Řídící jednotky motoru. Řídící jednotky ABS. Váha - průtokoměr vzduchu. orientační cena : 4500-5500,- Kč KATALOG Řídící jednotky Řídící jednotky ABS Váhy vzduchu Průtokoměry vzduchu Škrtící klapky Kombinované přístroje Displej, klima, rádia Navigační systémy Rozdělovače Obsah Ceny jsou uvedeny bez DPH Řídící

Více

Přehled jízd nostalgických vlaků

Přehled jízd nostalgických vlaků Přehled jízd nostalgických vlaků www.cd.cz/nostalgie VÁŽENÍ PŘÁTELÉ ŽELEZNICE, Tím, že jste otevřeli tento kalendář nostalgických jízd historických vlaků Nostalgie 2015, máte možnost cestovat po železnici

Více

Operačnívýkony v gynekologii a porodnictví

Operačnívýkony v gynekologii a porodnictví Operačnívýkony v gynekologii a porodnictví As. MUDr. Martin Petrenko Gynekol. - porod. klinika MU a FN Brno přednosta prof. MUDr. Ventruba, CSc. Operační gynekologie- obecný úvod Vyčlenění z chirurgie

Více

VYSOKÁ ŠKOLA ZDRAVOTNÍCTVA A SOCIÁLNEJ PRÁCE SV. ALŽBETY HOSPIC - SOCIÁLNÍ FENOMÉN MODERNÍ SPOLEČNOSTI

VYSOKÁ ŠKOLA ZDRAVOTNÍCTVA A SOCIÁLNEJ PRÁCE SV. ALŽBETY HOSPIC - SOCIÁLNÍ FENOMÉN MODERNÍ SPOLEČNOSTI VYSOKÁ ŠKOLA ZDRAVOTNÍCTVA A SOCIÁLNEJ PRÁCE SV. ALŽBETY HOSPIC - SOCIÁLNÍ FENOMÉN MODERNÍ SPOLEČNOSTI Rigorózní práce Robert Huneš Bratislava 2008 VYSOKÁ ŠKOLA ZDRAVOTNÍCTVA A SOCIÁLNEJ PRÁCE SV. ALŽBETY

Více

APLIKAČNÍ MANUÁL Nopová fólie JUNOP

APLIKAČNÍ MANUÁL Nopová fólie JUNOP APLIKAČNÍ MANUÁL Nopová fólie JUNOP Obsah: 1. Všeobecný popis výrobku... 2 2. Doporučení pro použití... 3 3. Technické parametry... 3 4. Spojování a kotvení... 4 5. Prostupy... 6 6. Klimatické podmínky...

Více

PŘIPOJOVACÍ PODMÍNKY NN pro osazení měřicích zařízení v odběrných místech napojených z distribuční sítě nízkého napětí

PŘIPOJOVACÍ PODMÍNKY NN pro osazení měřicích zařízení v odběrných místech napojených z distribuční sítě nízkého napětí PŘIPOJOVACÍ PODMÍNKY NN pro osazení měřicích zařízení v odběrných místech napojených z distribuční sítě nízkého napětí Vydává ČEZ Distribuce, a. s. Platnost od 1. 6. 2015 ČEZ Distribuce, a. s. www.cezdistribuce.cz

Více

35. TYPY ZLOMENIN A JEJICH DISLOKACE

35. TYPY ZLOMENIN A JEJICH DISLOKACE 35. TYPY ZLOMENIN A JEJICH DISLOKACE zlomenina porušení kontinuity kosti (úplné i neúplné) vznikající mechanismem přímým (působení sil přímo v místě zlomeniny) nepřímým (síla působí v oblasti vzdálené

Více

CENÍK HUTNÍCH MATERIÁLŮ

CENÍK HUTNÍCH MATERIÁLŮ HUTNÍ A SPOJOVACÍ MATERIÁL NÁŘADÍ / ZÁMEČNICKÉ POTŘEBY BRUSIVO / BARVY LAKY PRODEJNA PRAHA PRODEJNA A SÍDLO SPOLEČNOSTI PRAHA - LIBEŇ Kutnohorská 309/84 Na Stráži 2231/33a 109 00 Praha 10 180 00 Praha

Více

Česká správa sociálního zabezpečení (ČSSZ)

Česká správa sociálního zabezpečení (ČSSZ) Česká správa sociálního zabezpečení (ČSSZ) Ústředí ČSSZ Adresa: Křížová 25, 225 08 Praha 5 Telefonní ústředna: +420 257 061 111 Adresa e-podatelny: posta@cssz.cz Regionální pracoviště ČSSZ (včetně Okresních

Více

Martin Herodek. Microsoft Windows 10. Podrobná uživatelská příručka

Martin Herodek. Microsoft Windows 10. Podrobná uživatelská příručka Martin Herodek Microsoft Windows 10 Podrobná uživatelská příručka Computer Press Brno 2015 Microsoft Windows 10 Podrobná uživatelská příručka Martin Herodek Obálka: Martin Sodomka Odpovědný redaktor: Martin

Více

BE-ON-ROAD UŽIVATELSKÁ PŘÍRUČKA

BE-ON-ROAD UŽIVATELSKÁ PŘÍRUČKA BE-ON-ROAD UŽIVATELSKÁ PŘÍRUČKA i 1. SYSTÉMOVÉ POŽADAVKY... 4 1.1. PODPOROVANÉ OPERAČNÍ SYSTÉMY... 4 1.2. POŽADAVKY NA HARDWARE... 4 2. INSTALACE... 5 2.1. INSTALACE PŘES BE-ON-ROAD WIZARD... 5 2.2. INSTALACE

Více

PRAŽSKÁ INTEGROVANÁ DOPRAVA

PRAŽSKÁ INTEGROVANÁ DOPRAVA 9 Možný přestup: Ústí n.l. na příměstskou autobusovou linku PID 72 na přívoz Sedlec Zámky Mělník 11 7 Automat na prodej jednotlivých jízdenek PID: Louny 111 Mladá oleslav Vraňany umístěný v železniční

Více

POKYNY. k vyplnění Přiznání k dani z nabytí nemovitých věcí

POKYNY. k vyplnění Přiznání k dani z nabytí nemovitých věcí POKYNY k vyplnění Přiznání k dani z nabytí nemovitých věcí podle zákonného opatření Senátu č. 340/2013 Sb., o dani z nabytí nemovitých věcí (dále jen zákonné opatření ) Tiskopis daňového přiznání (dále

Více

Telefonní seznam kontaktů na výpravčí ve službě ve vybraných ŽST sítě ČD Číslo ŽST 9722 54355 MOBIL 723 806 594

Telefonní seznam kontaktů na výpravčí ve službě ve vybraných ŽST sítě ČD Číslo ŽST 9722 54355 MOBIL 723 806 594 Telefonní seznam kontaktů na výpravčí ve službě ve vybraných ŽST sítě ČD Číslo ŽST telefonu Funkce zaměstnance Adamov 9726 22155 Albrechtice u Českého Těšína 9727 51428 Aš 9724 44715, 44745 Bakov nad Jizerou

Více

Návod ke snadné instalaci ADSL2+ modemu ZyXEL P-660HW-T3 v2

Návod ke snadné instalaci ADSL2+ modemu ZyXEL P-660HW-T3 v2 Návod ke snadné instalaci ADSL2+ modemu ZyXEL P-660HW-T3 v2 Vážený zákazníku, blahopřejeme Vám ke koupi samoinstalačního balíčku ke službě T-Mobile ADSL. Přečtěte si prosím pozorně tuto instalační příručku,

Více

Horizon HD DVR Mediabox

Horizon HD DVR Mediabox Horizon HD DVR Mediabox ÚVOD Klíčové vlastnosti... 3 Boxy Horizon HD DVR a Horizon HD... 3 HORIZON HD DVR Obsah balení...4 Váš box Horizon HD DVR... 5 Dálkový ovladač Horizon představení...6 ZAČÍNÁME 1

Více

VÝPOČET TOLEROVANÝCH ROZMĚRŮ

VÝPOČET TOLEROVANÝCH ROZMĚRŮ VÝPOČET TOLEROVANÝCH ROZMĚRŮ OBSAH ZADÁNÍ ÚLOHY... 2 ŘEŠENÍ ÚLOHY... 2 Uložení s vůlí.... 2 Výpočet:...4 Uložení s přesahem.... 5 Výpočet:...5 Uložení přechodné... 6 Výpočet:...7 ŘEŠENÍ ÚLOHY... 8 LITERATURA...

Více

Tarif Profi na míru 4 neobsahuje žádné volné datové jednotky, pokud není v Rámcové smlouvě sjednáno jinak.

Tarif Profi na míru 4 neobsahuje žádné volné datové jednotky, pokud není v Rámcové smlouvě sjednáno jinak. Hlasové služby Mobilní hlasové služby Tarify Profi na míru 4 Tarifní program Profi na míru 4 je určen pouze pro zákazníky s Rámcovou smlouvou a nevztahují se na něj žádné položkové množstevní slevy, pokud

Více

Příručka držitele platební karty. UniCredit Bank Czech Republic and Slovakia, a.s.

Příručka držitele platební karty. UniCredit Bank Czech Republic and Slovakia, a.s. Příručka držitele platební karty UniCredit Bank Czech Republic and Slovakia, a.s. 2 Příručka držitele platební karty UniCredit Bank Czech Republic and Slovakia, a.s. Obsah 1. TYP VAŠÍ KARTY 3 2. PRAKTICKÉ

Více

Dubské slavnosti Z OBSAHU...

Dubské slavnosti Z OBSAHU... zdarma Dubí Mstišov Běhánky Drahůnky Pozorka Bystřice Cínovec Dubské slavnosti Z OBSAHU... Slovo starosty... Z jednání RM... Změny v jízdních řádech... MP informuje... Sběr nebezpečného odpadu... Úklid

Více

Příloha č. 1. Třídní vzdělávací program Svět kolem nás

Příloha č. 1. Třídní vzdělávací program Svět kolem nás Příloha č. 1 Třídní vzdělávací program Svět kolem nás Organizace dne v mateřské škole 6.30-8.00 - příchod dětí, ranní hry dle volby a přání dětí 8.00-8.45 - didakticky cílené činnosti ve skupinách i individuálně,

Více

Oceňovací tabulka plnění za trvalé následky úrazu

Oceňovací tabulka plnění za trvalé následky úrazu Oceňovací tabulka plnění za trvalé následky úrazu Z 0026 (01/2014) Tabulky pro hodnocení úrazového pojištění Oceňovací tabulka plnění za trvalé následky úrazu kód 001 371 Zásady pro hodnocení trvalých

Více

Jak postupovat při výměně řidičského průkazu? Jak zjistím kde mi vydají (vymění) řidičský průkaz?

Jak postupovat při výměně řidičského průkazu? Jak zjistím kde mi vydají (vymění) řidičský průkaz? Jak postupovat při výměně řidičského průkazu? Odpověď naleznete v detailních údajích životní situace výměna řidičských průkazů zde. Jak zjistím kde mi vydají (vymění) řidičský průkaz? Na příslušném pracovišti

Více

Fundazol 50 WPregistrant: CNN

Fundazol 50 WPregistrant: CNN Fundazol 50 WPregistrant: CNN Postřikový systémový fungicid ve formě dispergovatelného prášku proti chorobám polních plodin, ovocných dřevin a okrasných rostlin. Účinná látka: benomyl 50 % tj. methyl 1-(buzylkarbamoyl)benzimidazol-2-ylkarbamát

Více

Stručný přehled medailí, plaket a odznaků Policie ČR. Michal Salak

Stručný přehled medailí, plaket a odznaků Policie ČR. Michal Salak Stručný přehled medailí, plaket a odznaků Policie ČR Michal Salak OBSAH Předmluva Historie a vznik ocenění u soudobé policie Ministerstvo vnitra ČR a Policejní prezídium České republiky Útvary s celorepublikovou

Více

Úplné znění zákona č. 361/2000 Sb. ke dni 1. červenci 2006

Úplné znění zákona č. 361/2000 Sb. ke dni 1. červenci 2006 Úplné znění zákona č. 361/2000 Sb. ke dni 1. červenci 2006 Úplné znění zákona č. 361/2000 Sb. ke dni 1. červenci 2006 Změny v zákoně jsou od dosavadního textu odlišeny následujícím způsobem: zákon č. 411/2005

Více

Pedagogika volného času

Pedagogika volného času Pedagogika volného času PhDr. Jiřina Pávková Katedra pedagogiky, Univerzita Karlova v Praze, Pedagogická fakulta d alší vzdělávání pedagogických pracovníků na PedF uk Praha (CZ.1.07/1.3.00/19.0002) 1 PEDAGOGIKA

Více

PŘESTUPNÍ ŘÁD PRO NEPROFESIONÁLNÍ FOTBALISTY

PŘESTUPNÍ ŘÁD PRO NEPROFESIONÁLNÍ FOTBALISTY PŘESTUPNÍ ŘÁD PRO NEPROFESIONÁLNÍ FOTBALISTY I Základní ustanovení článek 1 1. Tento přestupní řád stanoví podmínky, za nichž se uskutečňují změny klubové příslušnosti amatérských a neamatérských fotbalistů

Více

NÁJEMNÍ SMLOUVA O NÁJMU NEBYTOVÝCH PROSTOR

NÁJEMNÍ SMLOUVA O NÁJMU NEBYTOVÝCH PROSTOR Příloha č. 11 usnesení 10. Rady města Stříbra ze dne 01.04.2015 NÁJEMNÍ SMLOUVA O NÁJMU NEBYTOVÝCH PROSTOR Pronajímatel: Město Stříbro, se sídlem Stříbro, Masarykovo nám. čp. 1 zastoupené Správou ma Město

Více

002 HACCP Sanitační řád

002 HACCP Sanitační řád Název dokumentu HACCP Sanitační řád Provozovna [zadejte název provozovny] Provozovatel [zadejte firmu] IČ: [zadejte] Vypracoval [zadejte] Datum [datum vytvoření] Schválil [zadejte] Datum [datum schválení]

Více

Stavebniny speciál HORNBACH AKTUÁLNĚ. Zdící systémy. Stavební chemie. Stavební řezivo. Plotové systémy. Terasy a dlažby. www.hornbach.

Stavebniny speciál HORNBACH AKTUÁLNĚ. Zdící systémy. Stavební chemie. Stavební řezivo. Plotové systémy. Terasy a dlažby. www.hornbach. HORNBACH AKTUÁLNĚ Stavebniny speciál Zdící systéy Přehled sortientu 013 Stavební cheie Stavební řezivo Plotové systéy Terasy a dlažby www.hornbach.cz NYNÍ TAKÉ JAKO ONLINE OBJEDNÁVKA! Tento servis ůžete

Více

Zavařování na mnoho způsobů

Zavařování na mnoho způsobů Vyznejte se v pečivu Rozhovor o vaření s Dianou Kobzanovou 3. 2013 39 Kč 1,70 EUR Zavařování na mnoho způsobů Časopis o kvalitě jídla TEST KVALITY: Vypátrali jsme ten nejlepší sterilovaný hrášek Tajemství

Více

Jak se stravovat při diabetu 2. typu

Jak se stravovat při diabetu 2. typu Jak se stravovat při diabetu 2. typu Diabetes mellitus Diabetes mellitus (cukrovka) je metabolická porucha, projevující se zvýšenou hladinou cukru v krvi. Jde o onemocnění, při kterém je relativní nebo

Více

Nové registrační značky v ČR

Nové registrační značky v ČR Nové registrační značky v ČR 2 Nové registrační značky v České republice Základní informace Problematiku registračních značek upravuje zákon č. 56/2001 Sb., o podmínkách provozu vozidel na pozemních komunikacích

Více

DĚJINY ČESKÉ. chronologický přehled. Územní, národnostní a státoprávní poměry

DĚJINY ČESKÉ. chronologický přehled. Územní, národnostní a státoprávní poměry DĚJINY ČESKÉ chronologický přehled Panovníci a hlavy státu Územní, národnostní a státoprávní poměry Jiné významné události zhruba od 4. stol. př. n. 1. České země zhruba od 4. stol. př. n. 1. osídleny

Více

Oceňovací tabulky vydávané Českou pojišťovnou a.s. pro stanovení výše pojistného plnění z úrazového pojištění

Oceňovací tabulky vydávané Českou pojišťovnou a.s. pro stanovení výše pojistného plnění z úrazového pojištění Oceňovací tabulky vydávané Českou pojišťovnou a.s. pro stanovení výše pojistného plnění z úrazového pojištění TABULKA A Plnění za dobu nezbytného léčení úrazu (denní plnění) pol. DIAGNÓZA DNL - 8 DNL -

Více

Seznam státních zástupců bývalých členů KSČ

Seznam státních zástupců bývalých členů KSČ Seznam státních zástupců bývalých členů KSČ Seznam státních zástupců s údaji o jejich politické příslušnosti před listopadem 1989 je vytvořen z podkladů k jejich jmenování do funkce. Seznam není úplný,

Více

Normální hodnoty hladiny krevního cukru u zdravých lidí

Normální hodnoty hladiny krevního cukru u zdravých lidí Úvod Diabetes mellitus úplavice cukrová, lidově cukrovka je nemoc postihující miliony lidí. A jejich počty neustále narůstají. Světová zdravotnická organizace WHO z toho vyvozuje, že se počet diabetiků

Více

Ambulance klinické psychologie pro děti a dospělé Laboratoř PhDr. Mgr. Drahomíra Baštová Wildová

Ambulance klinické psychologie pro děti a dospělé Laboratoř PhDr. Mgr. Drahomíra Baštová Wildová Udělené akreditace k provádění dopravně psychologického vyšetření podle 87a odst. 4 zákona č. 361/2000 Sb., o provozu na pozemních komunikacích a o změnách některých zákonů (zákon o silničním provozu),

Více

VÝROBNA LAHŮDEK Hladké Životice

VÝROBNA LAHŮDEK Hladké Životice VÝROBNA LAHŮDEK Hladké Životice Katalog výrobků Doplňková výroba Rybí výrobky - uzenky Rauty Cukrářské výrobky Aspikové výrobky Chlebíčky - lahůdky Saláty - pomazánky VÝROBNA LAHŮDEK HLADKÉ ŽIVOTICE Nacházíme

Více

ELEKTROKOLOBĚŽKA (koloběžka s pomocným motorem) HUGO Bike. Typ 008 PRO

ELEKTROKOLOBĚŽKA (koloběžka s pomocným motorem) HUGO Bike. Typ 008 PRO ELEKTROKOLOBĚŽKA (koloběžka s pomocným motorem) HUGO Bike Typ 008 PRO Gratulujeme Vám k nákupu luxusní elektrokoloběžky HUGO Bike, která Vám dopřeje nevšední zážitek zdoláváním velkých dávek kilometrů

Více

Vaše Vodafone Vyúčtování

Vaše Vodafone Vyúčtování Dodavatel: Odběratel: Příjemce: Vodafone Czech Republic a.s. Česká pirátská strana Česká pirátská strana náměstí Junkových 2 Řehořova 943/19 155 00 Praha 5 13000 Praha Řehořova 943/19 Česká republika Česká

Více

Internetové bankovnictví Equa bank

Internetové bankovnictví Equa bank Internetové bankovnictví Equa bank Stránka 2 z 40 Obsah 1 INTERNETOVÉ BANKOVNICTVÍ EQUA BANK... 4 2 BEZPEČNOST... 4 3 PŘIHLÁŠENÍ DO INTERNETOVÉHO BANKOVNICT TVÍ... 4 4 CHYBNÉ PŘIHLÁŠENÍ / ZAPOMENUTÉ PŘIHLAŠOVACÍ

Více

NÁVOD K POUŽÍVÁNÍ, ŘÍZENÍ A ÚDRŽBĚ Vysokozdvižných vozíků DESTA

NÁVOD K POUŽÍVÁNÍ, ŘÍZENÍ A ÚDRŽBĚ Vysokozdvižných vozíků DESTA NÁVOD K POUŽÍVÁNÍ, ŘÍZENÍ A ÚDRŽBĚ Vysokozdvižných vozíků DESTA DV 16 35 A Zpracoval Martin Rosulek ml. POPIS VOZÍKU Vozík sestává z těchto hlavních skupin: 1) Hnací blok 2) Podvozek 3) Krytování 4) Zdvihací

Více

PALUBNÍ CAMERA, HD. příručka. Aby jste lépe využívali veškeré funkce Auto DVR, přečtěte si prosím návod před použitím pečlivě.

PALUBNÍ CAMERA, HD. příručka. Aby jste lépe využívali veškeré funkce Auto DVR, přečtěte si prosím návod před použitím pečlivě. PALUBNÍ CAMERA, HD příručka 87231 Aby jste lépe využívali veškeré funkce Auto DVR, přečtěte si prosím návod před použitím pečlivě. Pozor 1. Vložte paměťovou kartu do auta DVR a formátujte. Prosím vložte

Více

Parkování na Praze 3

Parkování na Praze 3 Parkování na Praze 3 V centrální části Prahy 3 se nacházejí parkovací zóny. Modré zóny jsou vyhrazené výhradně pro rezidenty, majitele nemovitostí a abonenty, kteří mají parkovací kartu. Je možné zde zastavit

Více

FORD FOCUS Návod k obsluze pro vlastníky

FORD FOCUS Návod k obsluze pro vlastníky FORD FOCUS Návod k obsluze pro vlastníky Informace, které obsahuje tato publikace, byly v okamžiku předání do tisku správné. Z důvodu dalšího vývoje si kdykoli vyhrazujeme právo na změnu specifikací, designu

Více

pardubicko - chrudimsko

pardubicko - chrudimsko RE/MAX Accord Pardubice a RE/MAX K Chrudim pardubicko - chrudimsko LISTOPAD 01 Distribuce ZDARMA, v lokalitách Pardubice, Chrudim, Hlinsko, Přelouč. Informace o nemovitostech platné k datu uzávěrky magazínu,

Více

Ceník Sluzeb. lázně sárvár LÉČEBNÉ A WELLNESS LÁZNĚ SÁRVÁR

Ceník Sluzeb. lázně sárvár LÉČEBNÉ A WELLNESS LÁZNĚ SÁRVÁR Ceník Sluzeb 2014 lázně sárvár LÉČEBNÉ A WELLNESS LÁZNĚ SÁRVÁR Lázně Celodenní vstupenka.................11,1 3,100 Ft Vstupenka od 16 hodin................6,6 1,850 Ft Vstupenka od 16 hodin................5,2

Více

1080P kamera do auta BDVR 02 NÁVOD NA OBSLUHU

1080P kamera do auta BDVR 02 NÁVOD NA OBSLUHU 1080P kamera do auta BDVR 02 NÁVOD NA OBSLUHU Základní informace: Dostala se Vám do rukou digitální HD (high definition) kamera s pokročilou technologií. Toto zařízení je současně HD video kamerou a také

Více

Fotbalový trénink dětí

Fotbalový trénink dětí Univerzita Palackého v Olomouci Fotbalový trénink dětí Radim Weisser Olomouc 2013 Oponenti: Mgr. Karel Hůlka, Ph.D. Mgr. František Jura Publikace byla zpracována a vydána v rámci projektu ESF Inovace kombinované

Více

AUTO KELLY. elektrokola cyklo příslušenství motocykly a skútry moto příslušenství kempink elektro, doplňky autokosmetika oleje, péče o auto, nářadí

AUTO KELLY. elektrokola cyklo příslušenství motocykly a skútry moto příslušenství kempink elektro, doplňky autokosmetika oleje, péče o auto, nářadí Platnost od 11. 5. do 7. 6. 2015 AUTO KELLY elektrokola cyklo příslušenství motocykly a skútry moto příslušenství kempink elektro, doplňky autokosmetika oleje, péče o auto, nářadí PRO VAŠE JARNÍ PUTOVÁNÍ

Více

Uživatelská příručka skútrů YUKI

Uživatelská příručka skútrů YUKI Uživatelská příručka skútrů YUKI Platí pro modely: 50 MATRIX, 50 SHOTGUN, 50 RX, 50 NEW SPEEDY, 50 QUICK, 50 MATRIX 4T 50 RACE, 50 WHIP 2T, 50WHIP 4T, 50 RALLY II., 50 JET, 50 REX, 100 SMILE, 125 SNAKE

Více

Příručka inventurníka DANTEM

Příručka inventurníka DANTEM Příručka inventurníka DANTEM Interní pravidla a postupy Verze: 2.18 Platnost od: 24. 7. 2015 Zodpovědná osoba: Pavla Hennerová Závazná pravidla pro výkon práce Toto jsou závazná pravidla, která musí dodržovat

Více

Domov důchodců Praha 4 Háje

Domov důchodců Praha 4 Háje Domov důchodců Praha 4 Háje KONTAKTNÍ INFORMACE Adresa: K Milíčovu 734 149 00 Praha 4 Telefon: 271 198 504, 271 198 412 E-mail: reditel@dd-haje.cz, socialni@dd-haje.cz Web: http://www.dd-haje.cz/ Objekt

Více

Obchodní podmínky pro Sberbank Online Banking

Obchodní podmínky pro Sberbank Online Banking Obchodní podmínky pro Sberbank Online Banking Účinné od 28. 2. 2013 I. Úvodní ustanovení Tyto obchodní podmínky (dále jen Podmínky ) jsou nedílnou součástí Smlouvy o elektronické komunikaci mezi bankou

Více

Vířivý bazén INTEX Pure Spa Octagon Bubble & Jet

Vířivý bazén INTEX Pure Spa Octagon Bubble & Jet Vířivý bazén INTEX Pure Spa Octagon Bubble & Jet SJB-HS-20 SJB-HS-30 Seite 1 von 23 Obsah 1 Bezpečnostní upozornění... 3 2 Vlastnosti výrobku... 5 3 Popis dílů... 6 4 Návod k sestavení... 8 4.1.1 Vyběr

Více

návod ke hře GWINT Gwint je karetní hra pro 2 hráče, ve které se spolu na bojišti utkají dvě armády.

návod ke hře GWINT Gwint je karetní hra pro 2 hráče, ve které se spolu na bojišti utkají dvě armády. návod ke hře GWINT Gwint je karetní hra pro 2 hráče, ve které se spolu na bojišti utkají dvě armády. Hráči se střídají a každý ve svém tahu na bojiště vynese jednu kartu. Na konci každého kola si hráči

Více

Schémata elektrických obvodů

Schémata elektrických obvodů Schémata elektrických obvodů Schémata elektrických obvodů Číslo linie napájení Elektrický obvod 30 Propojení s kladným pólem akumulátorové baterie 31 Kostra 15, 15a Propojení s kladným pólem akumulátorové

Více

Y3 Uživatelská příručka

Y3 Uživatelská příručka Y3 Uživatelská příručka Obsah Nejprve si přečtěte... 1 Bezpečnostní opatření... 1 Osobní údaje a bezpečnost dat... 2 Právní upozornění... 3 Začínáme... 6 Klíčové funkce na dosah ruky... 7 Důležité informace

Více

Lenovo. Uživatelská příručka. Před používáním počítače si přečtěte bezpečnostní upozornění a důležité rady v dodaných příručkách.

Lenovo. Uživatelská příručka. Před používáním počítače si přečtěte bezpečnostní upozornění a důležité rady v dodaných příručkách. Lenovo Uživatelská příručka Před používáním počítače si přečtěte bezpečnostní upozornění a důležité rady v dodaných příručkách. Poznámky Před používáním výrobku si přečtěte Příručka s bezpečnostními a

Více

ŠKODA FELICIA. Opravy a údržba. Jiří Schwarz

ŠKODA FELICIA. Opravy a údržba. Jiří Schwarz Jiří Schwarz ŠKODA FELICIA 99 00 Opravy a údržba OBSAH KNIHY ŠKODA AUTO a. s. A U T O RIZ O VA L A postupy oprav a seřizování svépomocí diagnostika poruch časový a kilometrový plán údržby elektrická schémata

Více

Novela školského zákona

Novela školského zákona Novela školského zákona V únoru 2015 Poslanecká sněmovna schválila návrh novely školského zákona a některých dalších zákonů (zákona o poskytování dotací soukromým školám, předškolním a školským zařízením,

Více

ŠKODA Fabia NÁVOD K OBSLUZE

ŠKODA Fabia NÁVOD K OBSLUZE ŠKODA Fabia NÁVOD K OBSLUZE Úvod Rozhodli jste se pro vozidlo Škoda, srdečně Vám děkujeme za Vaši důvěru. S novým vozidlem Škoda získáváte vozidlo s moderní technikou a rozsáhlým vybavením, které budete

Více

Návod pro uživatele DS150E. Dangerfield May 2009 V3.0 Delphi PSS

Návod pro uživatele DS150E. Dangerfield May 2009 V3.0 Delphi PSS Návod pro uživatele DS150E 1 OBSAH Hlavní součásti...3 Zápis do elektronické řídicí jednotky (OBD)...86 Pokyny k instalaci......5 Skenování... 89 Konfigurace technologie Bluetooth...26 Diagnostický program...39

Více

Nastavení internetu. Jak to lze jednoduše, Android

Nastavení internetu. Jak to lze jednoduše, Android internetu Jak to lze jednoduše, Android Jak na to? Mrkněte na mapu pokrytí, jste v místě pokrytí? Máte aktivní datové služby od SAZKAmobil? Zkuste manuální nastavení* Na dalších stránkách najdete jednoduchý

Více

Pravidla pro používání Klientské zóny České pojišťovny a.s.

Pravidla pro používání Klientské zóny České pojišťovny a.s. Pravidla pro používání Klientské zóny České pojišťovny a.s. I. Úvodní ustanovení 1. Klientskou zónou České pojišťovny a.s. (dále též KZ ) se rozumí aplikace dostupná na internetových stránkách České pojišťovny

Více

Servis 5. Dílenská příručka OCTAVIA II 2004. Topení, klimatizace Vydání 02.04. Servisní služby. Technické informace

Servis 5. Dílenská příručka OCTAVIA II 2004. Topení, klimatizace Vydání 02.04. Servisní služby. Technické informace Servis 5 Dílenská příručka OCTAVIA II 004 Topení, klimatizace Vydání 0.04 Servisní služby. Technické informace Printed in Czech Republic S00.570.00.5 5 Servis Toto dílo je autorskoprávně chráněno. Každé

Více

SPORTOVNĚ REKREAČNÍ AREÁL VRCHBĚLÁ MULTIFUNKČNÍ TURISTICKÉ CENTRUM

SPORTOVNĚ REKREAČNÍ AREÁL VRCHBĚLÁ MULTIFUNKČNÍ TURISTICKÉ CENTRUM Sídlo: Doudova 544/11, 147 00 Praha 4 Podolí Provozovna: Masarykova 62/109, 400 01 Ústí nad Labem IČ: 25423363, DIČ: CZ25423363 Název akce: SPORTOVNĚ REKREAČNÍ AREÁL VRCHBĚLÁ MULTIFUNKČNÍ TURISTICKÉ CENTRUM

Více

CHYBOVÉ KÓDY KONCERNU VW/ŠKODA

CHYBOVÉ KÓDY KONCERNU VW/ŠKODA CHYBOVÉ KÓDY KONCERNU VW/ŠKODA Dekadický Hexadec Blikací Význam chyby kód chyby kód kód 00000 0000 0000 Nezjištěna závada/konec komunikace 00257 0101 1112 Vstupní ventil ABS PL 00258 0102 1113 Elektromagnetický

Více

VYTVOŘENÍ ÚČTU LG SMART WORLD

VYTVOŘENÍ ÚČTU LG SMART WORLD VYTVOŘENÍ ÚČTU LG SMART WORLD Přihlášení a Registrace Copyright 2012 LG Electronics. All Rights Reserved. 01. Stlačením tlačítka Home na dálkovém ovladači spustíte úvodní obrazovku LG Smart TV. 01A. V

Více

Uživatelská příručka

Uživatelská příručka VMG1312-B30B Čtyřportová brána VDSL2 s bezdrátovou technologií 802.11n Uživatelská příručka IP Adresa Přihlašovací jméno Heslo http://10.0.0.138 admin admin 3/2014 www.zyxel.com Zařízení ZyXEL VMG1312-B30B

Více

60 dní - Jsme to co jíme - Ing. Petr Havlíček-jídelníček

60 dní - Jsme to co jíme - Ing. Petr Havlíček-jídelníček 60 dní - Jsme to co jíme - Ing. Petr Havlíček-jídelníček POTŘEBNÉ PŘÍSADY chuť a vůle POSTUP PŘÍPRAVY 1.den: Snídaně: 100ml, Čerstvá ovocná, ovocno-zeleninová šťáva, Naředit vodou 2:1 ve prospěch vody

Více

B310 LTE CPE Stručný návod

B310 LTE CPE Stručný návod B310 LTE CPE Stručný návod 3150XXXX_01 1 Seznámení s vaším B310 Indikátor napájení Indikátor síťového režimu Indikátor Wi-Fi / WPS Zap: B310 je zapnutý. Vyp: B310 je vypnutý. Trvale svítí azurová: připojeno

Více

Cukrárna Globus. Pekárna. Tipy pro nákup čerstvých dortů, zákusků a sladkého pečiva. Sladké pochutnání z vlastní výroby Pekárny Globus.

Cukrárna Globus. Pekárna. Tipy pro nákup čerstvých dortů, zákusků a sladkého pečiva. Sladké pochutnání z vlastní výroby Pekárny Globus. Pekárna Cukrárna Globus Tipy pro nákup čerstvých dortů, zákusků a sladkého pečiva. Sladké pochutnání z vlastní výroby Pekárny Globus. Objednejte si dort nebo zákusky na Vaši oslavu. Máte chuť na sladké?

Více

Základní pojmy účetnictví neziskových organizací

Základní pojmy účetnictví neziskových organizací Základní pojmy účetnictví neziskových organizací Dagmar Štěpánová Obsah 1. Obecné vztahy spolků a účetnictví.............. 3 2. Vyhláška 504.......................... 4 3. České účetní standardy.....................

Více

Servis 5. Dílenská příručka OCTAVIA II 2004. Motor 1,6/75 kw Vydání 02.04. Servisní služby. Technické informace BGU

Servis 5. Dílenská příručka OCTAVIA II 2004. Motor 1,6/75 kw Vydání 02.04. Servisní služby. Technické informace BGU Servis 5 Dílenská příručka OCTAVIA II 2004 Motor 1,6/75 kw Kód motoru BGU Servisní služby. Technické informace Printed in Czech Republic 5 Servis Toto dílo je autorskoprávně chráněno. Každé použití bez

Více

VIESMANN. Montážní a servisní návod VITOPEND 100-W. pro odborné pracovníky

VIESMANN. Montážní a servisní návod VITOPEND 100-W. pro odborné pracovníky Montážní a servisní návod pro odborné pracovníky VIESMANN Vitopend 100-W Typ WH1B, 10,5 až 24kWa13až 30 kw Plynový nástěnný a kombinovaný kotel pro provoz nezávislý na vzduchu místnosti Provedení na zemní

Více

Sodexo Cafeteria MojeBenefity

Sodexo Cafeteria MojeBenefity 2 V TOMTO ČÍSLE: Cafeteria MojeBenefity od Sodexo Vánoční bonus Sbírejte a recyklujte s námi Listopad = měsíc kvality Safety first, aneb dbejte své osobní bezpečnosti Tokio - město, které nikdy nespí Kalendář

Více

JAK ZAČÍT S SCD PĚT FÁZÍ POSTUPU

JAK ZAČÍT S SCD PĚT FÁZÍ POSTUPU JAK ZAČÍT S SCD JAK ZAČÍT S SCD PĚT FÁZÍ POSTUPU ÚVOD ÚVOD Představujeme vám plán postupu nasazování potravin při SCD. Je skvělou pomůckou při zavádění této výživy. Tělo přechází na zcela nový režim a

Více

Navigátor pro Android Manuál. 2015... MapFactor s.r.o.

Navigátor pro Android Manuál. 2015... MapFactor s.r.o. Navigátor pro Android Manuál I Navigator pro Android Obsah 0 Část I Úvod 4 Část II Instalace Navigátoru 6 1 Instalace aplikace... Navigátor 6 2 Instalace map... 7 Část III Práce s Navigátorem 14 1 Zadání

Více

NÁVOD NA MONTÁŽ, SEŘÍZENÍ A ÚDRŽBU PLASTOVÝCH OKEN A DVEŘÍ

NÁVOD NA MONTÁŽ, SEŘÍZENÍ A ÚDRŽBU PLASTOVÝCH OKEN A DVEŘÍ NÁVOD NA MONTÁŽ, SEŘÍZENÍ A ÚDRŽBU PLASTOVÝCH OKEN A DVEŘÍ Vážený zákazníku, dovolujeme si se na Vás tímto obrátit, abychom Vám poskytli alespoň základní množství důležitých infromací týkajících se montáže,

Více

Nařízení 561, 3821 a AETR

Nařízení 561, 3821 a AETR Nařízení 561, 3821 a AETR výtah z dokumentů pro řidiče user 2012 Obsah 1. Předpisy pro práci osádek: Dohoda AETR, nařízení (ES) 561/2006 a (EHS) 3821/85 4 Kdy se použije nařízení 561 a kdy AETR? 4 2. Nařízení

Více

OCEŇOVACÍ TABULKY. pro likvidaci pojistných událostí

OCEŇOVACÍ TABULKY. pro likvidaci pojistných událostí OCEŇOVACÍ TABULKY pro likvidaci pojistných událostí ze samostatného i doplňkového úrazového pojištění a pojištění pro případ pracovní neschopnosti sjednaného v rámci životního pojištění nebo komerčního

Více

www.hornbach.cz Zahradní katalog

www.hornbach.cz Zahradní katalog www.hornbach.cz Zahradní katalog rostliny a dekorace 010 Zahradní kalendář Vánoční stromy (i v kontejneru) Advent Dušičky Halloween podzim Podzimní cibuloviny Růže v kontejneru růže růže Velké trvalky

Více

ZÁKLADNÍ MONTÁŽNÍ NÁVOD

ZÁKLADNÍ MONTÁŽNÍ NÁVOD ZÁKLADNÍ MONTÁŽNÍ NÁVOD OBECNÉ ZÁSADY Tento montážní návod umožňuje zvládnout pokládku jednoduché střechy. Pro montáž na střechy členité a se složitějšími detaily si vždy vyžádejte bezplatnou konzultaci

Více

CENÍK HUTNÍCH MATERIÁLŮ

CENÍK HUTNÍCH MATERIÁLŮ HUTNÍ A SPOJOVACÍ MATERIÁL NÁŘADÍ / ZÁMEČNICKÉ POTŘEBY BRUSIVO / BARVY LAKY PRODEJNA PRAHA PRODEJNA A SÍDLO SPOLEČNOSTI PRAHA - LIBEŇ Kutnohorská 309/84 Na Stráži 2231/33a 109 00 Praha 10 180 00 Praha

Více

Drobný hmotný majetek

Drobný hmotný majetek DLOUHODOBÝ HMOTNÝ MAJETEK DLO str. 1 HESLA MAJÍ PEVNĚ STANOVENOU STRUKTURU Drobný hmotný majetek Právní úprava: Vyhláška č. 500/2002 Sb., ve znění pozdějších předpisů 7 Vymezení hmotného majetku 39 Informace

Více

FORD GALAXY / S-MAX Návod k obsluze pro vlastníky

FORD GALAXY / S-MAX Návod k obsluze pro vlastníky FORD GALAXY / S-MAX Návod k obsluze pro vlastníky Informace, které obsahuje tato publikace, byly v okamžiku předání do tisku správné. Z důvodu dalšího vývoje si kdykoli vyhrazujeme právo na změnu specifikací,

Více

Martin Herodek. Microsoft Windows 10. Podrobná uživatelská příručka

Martin Herodek. Microsoft Windows 10. Podrobná uživatelská příručka Martin Herodek Microsoft Windows 10 Podrobná uživatelská příručka Computer Press Brno 2015 Microsoft Windows 10 Podrobná uživatelská příručka Martin Herodek Obálka: Martin Sodomka Odpovědný redaktor: Martin

Více

Plošné dopravní zklidnění v Praze Karlíně výrazně zvýšilo dopravní nehodovost

Plošné dopravní zklidnění v Praze Karlíně výrazně zvýšilo dopravní nehodovost Ing. Jan Adámek, Ing. Jan Kapitán Technická správa komunikací hlavního města Prahy úsek dopravního inženýrství tel. 724 216 935 email jan.adamek@tskpraha.cz Článek pro konferenci Bezpečná dopravní infrastruktura

Více

fēnix 3 Návod k obsluze

fēnix 3 Návod k obsluze fēnix 3 Návod k obsluze Leden 2015 Vytištěno na Tchaj-wanu 190-01840-41_0A Všechna práva vyhrazena. Na základě autorských zákonů není povoleno tento návod kopírovat (jako celek ani žádnou jeho část) bez

Více

Léčebné obstřiky u onemocnění pohybového aparátu

Léčebné obstřiky u onemocnění pohybového aparátu Léčebné obstřiky u onemocnění pohybového aparátu MUDr. Jiří Šramhauser Samostatná ordinace praktického lékaře pro dospělé, Teplice Úvod Obstřiky je možno rozdělit na povrchní k ovlivnění bolesti v reflexních

Více

ELEKTROKOLOBĚŽKA (koloběžka s pomocným motorem) HUGO Bike. Typ 008 PRO

ELEKTROKOLOBĚŽKA (koloběžka s pomocným motorem) HUGO Bike. Typ 008 PRO ELEKTROKOLOBĚŽKA (koloběžka s pomocným motorem) HUGO Bike Typ 008 PRO Gratulujeme Vám k nákupu luxusní elektrokoloběžky HUGO Bike, která Vám dopřeje nevšední zážitek zdoláváním velkých dávek kilometrů

Více

PŘESTUPNÍ ŘÁD PRO NEPROFESIONÁLNÍ FOTBALISTY

PŘESTUPNÍ ŘÁD PRO NEPROFESIONÁLNÍ FOTBALISTY PŘESTUPNÍ ŘÁD PRO NEPROFESIONÁLNÍ FOTBALISTY I Základní ustanovení článek 1 1. Tento přestupní řád stanoví podmínky, za nichž se uskutečňují změny klubové příslušnosti amatérských a neamatérských fotbalistů

Více

Zkus být elektrikářem

Zkus být elektrikářem Zkus být elektrikářem I. Zásuvkový obvod - zjednodušený Komentář: Zásuvkové obvody se zřizují pro připojení spotřebičů vidlicí do zásuvky. Na zásuvkové obvody lze podle potřeby pevně připojit jednoúčelové

Více

Servis 5. Dílenská příručka OCTAVIA II 2004. Podvozek Vydání 02.04. Servisní služby. Technické informace. Printed in Czech Republic S00.5703.00.

Servis 5. Dílenská příručka OCTAVIA II 2004. Podvozek Vydání 02.04. Servisní služby. Technické informace. Printed in Czech Republic S00.5703.00. Servis 5 Dílenská příručka OCTAVIA II 004 Podvozek Vydání 0.04 Servisní služby. Technické informace Printed in Czech Republic 5 Servis Toto dílo je autorskoprávně chráněno. Každé použití bez souhlasu autora

Více

KŘIŠŤÁLOVĚ ČISTÝ BAZÉN

KŘIŠŤÁLOVĚ ČISTÝ BAZÉN KŘIŠŤÁLOVĚ ČISTÝ BAZÉN Zprovoznění bazénu - příprava na novou sezónu Průběžné ošetřování bazénu Zakalený bazén, výskyt řas, zazimování Bezchlorová řada Whirlpooly Novinky a speciality kompletní chlorová

Více

002 HACCP Sanitační řád

002 HACCP Sanitační řád Název dokumentu HACCP Sanitační řád Provozovna [zadejte název provozovny] Provozovatel [zadejte firmu] IČ: [zadejte] Vypracoval [zadejte] Datum [datum vytvoření] Schválil [zadejte] Datum [datum schválení]

Více

Jak šmakuje Moravskoslezsko

Jak šmakuje Moravskoslezsko Jak šmakuje Moravskoslezsko 2012 Kuchařka krajových receptů Vážení milovníci tradiční kuchyně, dostala se Vám do rukou v pořadí druhá Moravskoslezská kuchařka pod značkou Jak šmakuje Moravskoslezsko. První

Více

TOTAL GYM. Návod k použití. Příručka ke cvičení

TOTAL GYM. Návod k použití. Příručka ke cvičení TOTAL GYM Návod k použití Příručka ke cvičení (V překladu odkazujeme na obrázky v originální anglické příručce EXERCISE BOOKLET dodávané společně se strojem.) Při překladu pro nás byla důležitější srozumitelnost

Více

NÁVOD K POUŽÍVÁNÍ, ŘÍZENÍ A ÚDRŽBĚ Vysokozdvižných vozíků DESTA

NÁVOD K POUŽÍVÁNÍ, ŘÍZENÍ A ÚDRŽBĚ Vysokozdvižných vozíků DESTA NÁVOD K POUŽÍVÁNÍ, ŘÍZENÍ A ÚDRŽBĚ Vysokozdvižných vozíků DESTA DV 16 35 A Zpracoval Martin Rosulek ml. POPIS VOZÍKU Vozík sestává z těchto hlavních skupin: 1) Hnací blok 2) Podvozek 3) Krytování 4) Zdvihací

Více

Ceník Sluzeb. lázně sárvár LÉČEBNÉ A WELLNESS LÁZNĚ SÁRVÁR

Ceník Sluzeb. lázně sárvár LÉČEBNÉ A WELLNESS LÁZNĚ SÁRVÁR Ceník Sluzeb 2014 lázně sárvár LÉČEBNÉ A WELLNESS LÁZNĚ SÁRVÁR Lázně Celodenní vstupenka.................11,1 3,100 Ft Vstupenka od 16 hodin................6,6 1,850 Ft Vstupenka od 16 hodin................5,2

Více

35. TYPY ZLOMENIN A JEJICH DISLOKACE

35. TYPY ZLOMENIN A JEJICH DISLOKACE 35. TYPY ZLOMENIN A JEJICH DISLOKACE zlomenina porušení kontinuity kosti (úplné i neúplné) vznikající mechanismem přímým (působení sil přímo v místě zlomeniny) nepřímým (síla působí v oblasti vzdálené

Více

PRAŽSKÁ INTEGROVANÁ DOPRAVA

PRAŽSKÁ INTEGROVANÁ DOPRAVA 9 Možný přestup: Ústí n.l. na příměstskou autobusovou linku PID 72 na přívoz Sedlec Zámky Mělník 11 7 Automat na prodej jednotlivých jízdenek PID: Louny 111 Mladá oleslav Vraňany umístěný v železniční

Více

Ceník prací na rok 2015

Ceník prací na rok 2015 Ceník prací na rok 2015 Ceník prací HSV i PSV je pouze orientační. Přesnou cenu stanovíme po prohlídce nemovitosti a konzultaci se zákazníkem. Cena, za kterou provádíme jednotlivé práce je závislá i na

Více

Uživatelská příručka. Sygic GPS Navigation. v3 (Mobile) 2011 Sygic, a.s. Všechna práva vyhrazena.

Uživatelská příručka. Sygic GPS Navigation. v3 (Mobile) 2011 Sygic, a.s. Všechna práva vyhrazena. Uživatelská příručka Sygic GPS Navigation v3 (Mobile) 2011 Sygic, a.s. Všechna práva vyhrazena. I. Začínáme...2 Zadávání adresy...4 Turn by Turn navigace...8 Vyhledávání GPS pozice...9 II. Plánování trasy...

Více

Horizon HD DVR Mediabox

Horizon HD DVR Mediabox Horizon HD DVR Mediabox ÚVOD Klíčové vlastnosti... 3 Boxy Horizon HD DVR a Horizon HD... 3 HORIZON HD DVR Obsah balení...4 Váš box Horizon HD DVR... 5 Dálkový ovladač Horizon představení...6 ZAČÍNÁME 1

Více

Česká správa sociálního zabezpečení (ČSSZ)

Česká správa sociálního zabezpečení (ČSSZ) Česká správa sociálního zabezpečení (ČSSZ) Ústředí ČSSZ Adresa: Křížová 25, 225 08 Praha 5 Telefonní ústředna: +420 257 061 111 Adresa e-podatelny: posta@cssz.cz Regionální pracoviště ČSSZ (včetně Okresních

Více

BE-ON-ROAD UŽIVATELSKÁ PŘÍRUČKA

BE-ON-ROAD UŽIVATELSKÁ PŘÍRUČKA BE-ON-ROAD UŽIVATELSKÁ PŘÍRUČKA i 1. SYSTÉMOVÉ POŽADAVKY... 4 1.1. PODPOROVANÉ OPERAČNÍ SYSTÉMY... 4 1.2. POŽADAVKY NA HARDWARE... 4 2. INSTALACE... 5 2.1. INSTALACE PŘES BE-ON-ROAD WIZARD... 5 2.2. INSTALACE

Více

APLIKAČNÍ MANUÁL Nopová fólie JUNOP

APLIKAČNÍ MANUÁL Nopová fólie JUNOP APLIKAČNÍ MANUÁL Nopová fólie JUNOP Obsah: 1. Všeobecný popis výrobku... 2 2. Doporučení pro použití... 3 3. Technické parametry... 3 4. Spojování a kotvení... 4 5. Prostupy... 6 6. Klimatické podmínky...

Více

Fundazol 50 WPregistrant: CNN

Fundazol 50 WPregistrant: CNN Fundazol 50 WPregistrant: CNN Postřikový systémový fungicid ve formě dispergovatelného prášku proti chorobám polních plodin, ovocných dřevin a okrasných rostlin. Účinná látka: benomyl 50 % tj. methyl 1-(buzylkarbamoyl)benzimidazol-2-ylkarbamát

Více

POKYNY. k vyplnění Přiznání k dani z nabytí nemovitých věcí

POKYNY. k vyplnění Přiznání k dani z nabytí nemovitých věcí POKYNY k vyplnění Přiznání k dani z nabytí nemovitých věcí podle zákonného opatření Senátu č. 340/2013 Sb., o dani z nabytí nemovitých věcí (dále jen zákonné opatření ) Tiskopis daňového přiznání (dále

Více

Domov důchodců Praha 4 Háje

Domov důchodců Praha 4 Háje Domov důchodců Praha 4 Háje KONTAKTNÍ INFORMACE Adresa: K Milíčovu 734 149 00 Praha 4 Telefon: 271 198 504, 271 198 412 E-mail: reditel@dd-haje.cz, socialni@dd-haje.cz Web: http://www.dd-haje.cz/ Objekt

Více

Úplné znění zákona č. 361/2000 Sb. ke dni 1. červenci 2006

Úplné znění zákona č. 361/2000 Sb. ke dni 1. červenci 2006 Úplné znění zákona č. 361/2000 Sb. ke dni 1. červenci 2006 Úplné znění zákona č. 361/2000 Sb. ke dni 1. červenci 2006 Změny v zákoně jsou od dosavadního textu odlišeny následujícím způsobem: zákon č. 411/2005

Více

Invazivní nepůvodní druhy

Invazivní nepůvodní druhy Květen 2009 Invazivní nepůvodní druhy CS Příroda a biologická rozmanitost Invazivní druhy představují významnou a rychle narůstající hrozbu pro původní biologickou rozmanitost v Evropě. Rostliny a živočichové,

Více

Tarif Profi na míru 4 neobsahuje žádné volné datové jednotky, pokud není v Rámcové smlouvě sjednáno jinak.

Tarif Profi na míru 4 neobsahuje žádné volné datové jednotky, pokud není v Rámcové smlouvě sjednáno jinak. Hlasové služby Mobilní hlasové služby Tarify Profi na míru 4 Tarifní program Profi na míru 4 je určen pouze pro zákazníky s Rámcovou smlouvou a nevztahují se na něj žádné položkové množstevní slevy, pokud

Více

Přehled jízd nostalgických vlaků

Přehled jízd nostalgických vlaků Přehled jízd nostalgických vlaků www.cd.cz/nostalgie VÁŽENÍ PŘÁTELÉ ŽELEZNICE, Tím, že jste otevřeli tento kalendář nostalgických jízd historických vlaků Nostalgie 2015, máte možnost cestovat po železnici

Více

Obsah. orientační cena : 5500,- Kč. Řídící jednotky motoru. Řídící jednotky ABS. Váha - průtokoměr vzduchu. orientační cena : 4500-5500,- Kč

Obsah. orientační cena : 5500,- Kč. Řídící jednotky motoru. Řídící jednotky ABS. Váha - průtokoměr vzduchu. orientační cena : 4500-5500,- Kč KATALOG Řídící jednotky Řídící jednotky ABS Váhy vzduchu Průtokoměry vzduchu Škrtící klapky Kombinované přístroje Displej, klima, rádia Navigační systémy Rozdělovače Obsah Ceny jsou uvedeny bez DPH Řídící

Více

chtěl bych Vám ukázat úplně jinou možnost spoření, než jakou jste nejspíš znali doposud.

chtěl bych Vám ukázat úplně jinou možnost spoření, než jakou jste nejspíš znali doposud. VS Dobrý den, chtěl bych Vám ukázat úplně jinou možnost spoření, než jakou jste nejspíš znali doposud. Můj názor je, že když si spořím, tak ať to stojí za to. Nyní Vám ukážu na porovnání, jak a kde lze

Více

Telefonní seznam kontaktů na výpravčí ve službě ve vybraných ŽST sítě ČD Číslo ŽST 9722 54355 MOBIL 723 806 594

Telefonní seznam kontaktů na výpravčí ve službě ve vybraných ŽST sítě ČD Číslo ŽST 9722 54355 MOBIL 723 806 594 Telefonní seznam kontaktů na výpravčí ve službě ve vybraných ŽST sítě ČD Číslo ŽST telefonu Funkce zaměstnance Adamov 9726 22155 Albrechtice u Českého Těšína 9727 51428 Aš 9724 44715, 44745 Bakov nad Jizerou

Více

TPG Domovní plynovody G 704 01

TPG Domovní plynovody G 704 01 TPG Domovní plynovody G 704 01 TECHNICKÁ PRAVIDLA ODBĚRNÁ PLYNOVÁ ZAŘÍZENÍ A SPOTŘEBIČE NA PLYNNÁ PALIVA V BUDOVÁCH GAS INSTALLATION PIPEWORK AND APPLIANCES FOR BUILDINGS Schválena dne: 29. 5. 2013 Registrace

Více

Kodování a přizpůsobení jednotek Fábia

Kodování a přizpůsobení jednotek Fábia Kodování a přizpůsobení jednotek Fábia 1. centrální řídící jednotka BSG (adresa 9) kódování (funkce 7) výbava aktivace funkce EKP (od 7/1) předčerpání paliva po otevření dveří hodnota 16384 zadní stěrač

Více

Příručka držitele platební karty. UniCredit Bank Czech Republic and Slovakia, a.s.

Příručka držitele platební karty. UniCredit Bank Czech Republic and Slovakia, a.s. Příručka držitele platební karty UniCredit Bank Czech Republic and Slovakia, a.s. 2 Příručka držitele platební karty UniCredit Bank Czech Republic and Slovakia, a.s. Obsah 1. TYP VAŠÍ KARTY 3 2. PRAKTICKÉ

Více

Operačnívýkony v gynekologii a porodnictví

Operačnívýkony v gynekologii a porodnictví Operačnívýkony v gynekologii a porodnictví As. MUDr. Martin Petrenko Gynekol. - porod. klinika MU a FN Brno přednosta prof. MUDr. Ventruba, CSc. Operační gynekologie- obecný úvod Vyčlenění z chirurgie

Více

KAMENINOVÉ TROUBY CENÍK 2014-03-01

KAMENINOVÉ TROUBY CENÍK 2014-03-01 KAMENINOVÉ TROUBY CENÍK 2014-03-01 You can t beat quality STEINZEUG KERAMO, s.r.o. Tel.: 387 981 303 Fax: 387 981 487 E-mail: keramo@keramo-kamenina.cz www.keramo-kamenina.cz 2 KOMENTÁŘ Ceník 2014-03-01

Více

VYSOKÁ ŠKOLA ZDRAVOTNÍCTVA A SOCIÁLNEJ PRÁCE SV. ALŽBETY HOSPIC - SOCIÁLNÍ FENOMÉN MODERNÍ SPOLEČNOSTI

VYSOKÁ ŠKOLA ZDRAVOTNÍCTVA A SOCIÁLNEJ PRÁCE SV. ALŽBETY HOSPIC - SOCIÁLNÍ FENOMÉN MODERNÍ SPOLEČNOSTI VYSOKÁ ŠKOLA ZDRAVOTNÍCTVA A SOCIÁLNEJ PRÁCE SV. ALŽBETY HOSPIC - SOCIÁLNÍ FENOMÉN MODERNÍ SPOLEČNOSTI Rigorózní práce Robert Huneš Bratislava 2008 VYSOKÁ ŠKOLA ZDRAVOTNÍCTVA A SOCIÁLNEJ PRÁCE SV. ALŽBETY

Více

Návod ke snadné instalaci ADSL2+ modemu ZyXEL P-660HW-T3 v2

Návod ke snadné instalaci ADSL2+ modemu ZyXEL P-660HW-T3 v2 Návod ke snadné instalaci ADSL2+ modemu ZyXEL P-660HW-T3 v2 Vážený zákazníku, blahopřejeme Vám ke koupi samoinstalačního balíčku ke službě T-Mobile ADSL. Přečtěte si prosím pozorně tuto instalační příručku,

Více

Xiaomi Redmi 3. uživatelská příručka

Xiaomi Redmi 3. uživatelská příručka Xiaomi Redmi 3 uživatelská příručka 2016 Bezpečnostní pokyny a informace Baterie Baterie v modelu Redmi 3 není uživatelsky vyměnitelná. Pokud si přejete baterii vyměnit, kontaktujte servis Xiaomi-Store.cz

Více

návod ke hře GWINT Gwint je karetní hra pro 2 hráče, ve které se spolu na bojišti utkají dvě armády.

návod ke hře GWINT Gwint je karetní hra pro 2 hráče, ve které se spolu na bojišti utkají dvě armády. návod ke hře GWINT Gwint je karetní hra pro 2 hráče, ve které se spolu na bojišti utkají dvě armády. Hráči se střídají a každý ve svém tahu na bojiště vynese jednu kartu. Na konci každého kola si hráči

Více

Jak se stravovat při diabetu 2. typu

Jak se stravovat při diabetu 2. typu Jak se stravovat při diabetu 2. typu Diabetes mellitus Diabetes mellitus (cukrovka) je metabolická porucha, projevující se zvýšenou hladinou cukru v krvi. Jde o onemocnění, při kterém je relativní nebo

Více

Jak postupovat při výměně řidičského průkazu? Jak zjistím kde mi vydají (vymění) řidičský průkaz?

Jak postupovat při výměně řidičského průkazu? Jak zjistím kde mi vydají (vymění) řidičský průkaz? Jak postupovat při výměně řidičského průkazu? Odpověď naleznete v detailních údajích životní situace výměna řidičských průkazů zde. Jak zjistím kde mi vydají (vymění) řidičský průkaz? Na příslušném pracovišti

Více

VÝROBNA LAHŮDEK Hladké Životice

VÝROBNA LAHŮDEK Hladké Životice VÝROBNA LAHŮDEK Hladké Životice Katalog výrobků Doplňková výroba Rybí výrobky - uzenky Rauty Cukrářské výrobky Aspikové výrobky Chlebíčky - lahůdky Saláty - pomazánky VÝROBNA LAHŮDEK HLADKÉ ŽIVOTICE Nacházíme

Více

Stavebniny speciál HORNBACH AKTUÁLNĚ. Zdící systémy. Stavební chemie. Stavební řezivo. Plotové systémy. Terasy a dlažby. www.hornbach.

Stavebniny speciál HORNBACH AKTUÁLNĚ. Zdící systémy. Stavební chemie. Stavební řezivo. Plotové systémy. Terasy a dlažby. www.hornbach. HORNBACH AKTUÁLNĚ Stavebniny speciál Zdící systéy Přehled sortientu 013 Stavební cheie Stavební řezivo Plotové systéy Terasy a dlažby www.hornbach.cz NYNÍ TAKÉ JAKO ONLINE OBJEDNÁVKA! Tento servis ůžete

Více

AMBULANTNÍ PRACOVIŠTĚ

AMBULANTNÍ PRACOVIŠTĚ AMBULANTNÍ PRACOVIŠTĚ Úvod Aktualizovaný seznam ambulancí navazuje na jeho první verzi z roku 2004. Tentokrát jsme jej rozšířili o nové ambulance v připojených nemocnicích Broumov a Opočno, samostatně

Více

Příloha č. 1. Třídní vzdělávací program Svět kolem nás

Příloha č. 1. Třídní vzdělávací program Svět kolem nás Příloha č. 1 Třídní vzdělávací program Svět kolem nás Organizace dne v mateřské škole 6.30-8.00 - příchod dětí, ranní hry dle volby a přání dětí 8.00-8.45 - didakticky cílené činnosti ve skupinách i individuálně,

Více

FORD FOCUS Návod k obsluze pro vlastníky

FORD FOCUS Návod k obsluze pro vlastníky FORD FOCUS Návod k obsluze pro vlastníky Informace, které obsahuje tato publikace, byly v okamžiku předání do tisku správné. Z důvodu dalšího vývoje si kdykoli vyhrazujeme právo na změnu specifikací, designu

Více

NÁJEMNÍ SMLOUVA O NÁJMU NEBYTOVÝCH PROSTOR

NÁJEMNÍ SMLOUVA O NÁJMU NEBYTOVÝCH PROSTOR Příloha č. 11 usnesení 10. Rady města Stříbra ze dne 01.04.2015 NÁJEMNÍ SMLOUVA O NÁJMU NEBYTOVÝCH PROSTOR Pronajímatel: Město Stříbro, se sídlem Stříbro, Masarykovo nám. čp. 1 zastoupené Správou ma Město

Více

MANUÁL K LUŠTĚNÍ ŠIFER

MANUÁL K LUŠTĚNÍ ŠIFER FHJŮMPŮDFJKEPDFMDMVCŮPJMFNONSLNCSLOCNSPCNPSDESLNVCSLPJMCVSDOP VNHOPWNFOWPFNCŮSPŮ MXP MXPS MXPCSKBCSOKBCSNCSCKCSDKJVNODVNOVM MANUÁL K FHJŮMPŮDFJKEPDFMDMVCŮPJMFNONDESVMDSVPDSMVSPCSPCMKSPYCMSPCYSP LUŠTĚNÍ

Více

Obchodní podmínky pro Sberbank Online Banking

Obchodní podmínky pro Sberbank Online Banking Obchodní podmínky pro Sberbank Online Banking Účinné od 28. 2. 2013 I. Úvodní ustanovení Tyto obchodní podmínky (dále jen Podmínky ) jsou nedílnou součástí Smlouvy o elektronické komunikaci mezi bankou

Více

Oceňovací tabulka plnění za trvalé následky úrazu

Oceňovací tabulka plnění za trvalé následky úrazu Oceňovací tabulka plnění za trvalé následky úrazu Z 0026 (01/2014) Tabulky pro hodnocení úrazového pojištění Oceňovací tabulka plnění za trvalé následky úrazu kód 001 371 Zásady pro hodnocení trvalých

Více

Příručka pro uživatele

Příručka pro uživatele Příručka pro uživatele Na internetovém portálu SERVICE BOX umožňuje PEUGEOT bezplatné a snadné konzultování dokumentace k vozidlu online. Stránky SERVICE BOX se srozumitelným a ergonomickým uspořádáním

Více

Uživatelská příručka Nokia 225 Dual SIM

Uživatelská příručka Nokia 225 Dual SIM Uživatelská příručka Nokia 225 Dual SIM 1.1. vydání CS Uživatelská příručka Nokia 225 Dual SIM Obsah Bezpečnost 3 Začínáme 4 Tlačítka a části 4 Vložení SIM karty, baterie a paměťové karty 4 Nabíjení baterie

Více

DĚJINY ČESKÉ. chronologický přehled. Územní, národnostní a státoprávní poměry

DĚJINY ČESKÉ. chronologický přehled. Územní, národnostní a státoprávní poměry DĚJINY ČESKÉ chronologický přehled Panovníci a hlavy státu Územní, národnostní a státoprávní poměry Jiné významné události zhruba od 4. stol. př. n. 1. České země zhruba od 4. stol. př. n. 1. osídleny

Více

VÝPOČET TOLEROVANÝCH ROZMĚRŮ

VÝPOČET TOLEROVANÝCH ROZMĚRŮ VÝPOČET TOLEROVANÝCH ROZMĚRŮ OBSAH ZADÁNÍ ÚLOHY... 2 ŘEŠENÍ ÚLOHY... 2 Uložení s vůlí.... 2 Výpočet:...4 Uložení s přesahem.... 5 Výpočet:...5 Uložení přechodné... 6 Výpočet:...7 ŘEŠENÍ ÚLOHY... 8 LITERATURA...

Více

pro nového zaměstnance Dopravního podniku hl. m. Prahy, akciové společnosti

pro nového zaměstnance Dopravního podniku hl. m. Prahy, akciové společnosti Praktické informace pro nového zaměstnance Dopravního podniku hl. m. Prahy, akciové společnosti Obsah: www.dpp.cz Dopravní podnik zaměstnancům Na úvod 3 O Dopravním podniku 4 TOP management DPP 5 Z historie

Více

Stručný přehled medailí, plaket a odznaků Policie ČR. Michal Salak

Stručný přehled medailí, plaket a odznaků Policie ČR. Michal Salak Stručný přehled medailí, plaket a odznaků Policie ČR Michal Salak OBSAH Předmluva Historie a vznik ocenění u soudobé policie Ministerstvo vnitra ČR a Policejní prezídium České republiky Útvary s celorepublikovou

Více

Marine program. Návod k obsluze a servisní knížka

Marine program. Návod k obsluze a servisní knížka Marine program Návod k obsluze a servisní knížka BF 5 A Návod k obsluze lodního motoru HONDA BF 5 A Děkujeme Vám za nákup lodního motoru značky HONDA. Tento návod k obsluze obsahuje informace o provozu

Více

Ambulance klinické psychologie pro děti a dospělé Laboratoř PhDr. Mgr. Drahomíra Baštová Wildová

Ambulance klinické psychologie pro děti a dospělé Laboratoř PhDr. Mgr. Drahomíra Baštová Wildová Udělené akreditace k provádění dopravně psychologického vyšetření podle 87a odst. 4 zákona č. 361/2000 Sb., o provozu na pozemních komunikacích a o změnách některých zákonů (zákon o silničním provozu),

Více

Katalog prací. uplatňování podle povolání a platových tříd ve veřejných službách a správě. edice práce mzdy pojištění. František Alinče Ivan Tomší

Katalog prací. uplatňování podle povolání a platových tříd ve veřejných službách a správě. edice práce mzdy pojištění. František Alinče Ivan Tomší František Alinče Ivan Tomší Katalog prací uplatňování podle povolání a platových tříd ve veřejných službách a správě 1. vydání edice práce mzdy pojištění k 1. 10. 2010 V případě, že dojde k významným legislativním

Více

1080P kamera do auta BDVR 02 NÁVOD NA OBSLUHU

1080P kamera do auta BDVR 02 NÁVOD NA OBSLUHU 1080P kamera do auta BDVR 02 NÁVOD NA OBSLUHU Základní informace: Dostala se Vám do rukou digitální HD (high definition) kamera s pokročilou technologií. Toto zařízení je současně HD video kamerou a také

Více

AOK-Information für tschechische Grenzgänger und ihre Familienangehörigen

AOK-Information für tschechische Grenzgänger und ihre Familienangehörigen Gesundheit in besten Händen Informace AOK pro české příhraniční pracovníky a jejich rodinné příslušníky AOK-Information für tschechische Grenzgänger und ihre Familienangehörigen Gesundheit in besten Händen

Více

PŘIPOJOVACÍ PODMÍNKY NN pro osazení měřicích zařízení v odběrných místech napojených z distribuční sítě nízkého napětí

PŘIPOJOVACÍ PODMÍNKY NN pro osazení měřicích zařízení v odběrných místech napojených z distribuční sítě nízkého napětí PŘIPOJOVACÍ PODMÍNKY NN pro osazení měřicích zařízení v odběrných místech napojených z distribuční sítě nízkého napětí Vydává ČEZ Distribuce, a. s. Platnost od 1. 6. 2015 ČEZ Distribuce, a. s. www.cezdistribuce.cz

Více

Seznam prodejních míst ryb u členů Rybářského sdružení ČR:

Seznam prodejních míst ryb u členů Rybářského sdružení ČR: Seznam prodejních míst ryb u členů Rybářského sdružení ČR: Společnost strana Blatenská ryba s.r.o. 2 Rybářství Hluboká cz. s.r.o. 3 Rybářství Třeboň a.s. 4 Klatovské rybářství a.s. 5 Rybářství Mariánské

Více

Pedagogika volného času

Pedagogika volného času Pedagogika volného času PhDr. Jiřina Pávková Katedra pedagogiky, Univerzita Karlova v Praze, Pedagogická fakulta d alší vzdělávání pedagogických pracovníků na PedF uk Praha (CZ.1.07/1.3.00/19.0002) 1 PEDAGOGIKA

Více

ACARITEC. Návod k použití. ACARITEC je určen pro boj proti čmelíkovi kuřímu v chovech drůbeže. Je složen ze 2 substancí:

ACARITEC. Návod k použití. ACARITEC je určen pro boj proti čmelíkovi kuřímu v chovech drůbeže. Je složen ze 2 substancí: Pozor dřívější název BI-PROTEC bude v průběhu druhé poloviny roku 2009 nahrazen názvem ACARITEC. Jedná se o shodný výrobek, stejného výrobce. Změna se týká opravdu pouze názvu. ACARITEC Účinný prostředek

Více

50 % sleva 1 + 1 -50 % 1+1 ZDARMA. platnost: Deo Natural Sprejů. Prémiový kupon - 50% na celý sortiment značky. na vybraný sortiment

50 % sleva 1 + 1 -50 % 1+1 ZDARMA. platnost: Deo Natural Sprejů. Prémiový kupon - 50% na celý sortiment značky. na vybraný sortiment 15. platnost: 23. 7. 1. 8. 2015 Skvělé ceny dětského sortimentu uvnitř» 40 dávek 30 dávek Persil prášek, gel 40 dávek, kapsle 30 dávek, * Doporučená cena dodavatele * 1 + 1 libovolná kombinace 359 179

Více

Uživatelská příručka skútrů YUKI

Uživatelská příručka skútrů YUKI Uživatelská příručka skútrů YUKI Platí pro modely: 50 MATRIX, 50 SHOTGUN, 50 RX, 50 NEW SPEEDY, 50 QUICK, 50 MATRIX 4T 50 RACE, 50 WHIP 2T, 50WHIP 4T, 50 RALLY II., 50 JET, 50 REX, 100 SMILE, 125 SNAKE

Více

Sociální síť

Udělejte svůj materiál přístupný co největšímu počtu lidí zveřejněním zde. Zjistěte, co si lidé myslí o Vaší práci.

Elektronická knihovna

Nahrajte neomezený počet dokumentů, dnes a vždy zdarma!

Vyhledávání a předávání zkušeností

Najděte užitečné materiály a sdílejte je s přáteli a kolegy tím, že jim zašlete odkaz na materiál.