Thursday, February 27, 14

Save this PDF as:
 WORD  PNG  TXT  JPG

Rozměr: px
Začít zobrazení ze stránky:

Download "Thursday, February 27, 14"

Transkript

1

2 DATABÁZE A VYHLEDÁVÁNÍ SEKVENCÍ MOLEKULÁRNÍ TAXONOMIE 2014 MARIAN NOVOTNÝ

3 PŘEDNÁŠEJÍCÍ Mgr. Marian NOVOTNÝ, PhD. vystudoval odbornou biologii na PřF UK, diplomka v laboratoři doc. Folka doktorát na Uppsalské univerzitě se specializací strukturní bioinformatika (Gerard Kleywegt) Marie Curie Fellow na Evropském Bioinformatickém Institutu (Janet Thornton & Roman Laskowski) ornitolog amatér

4 OSNOVA co je substrát pro molekulární taxonomii? kde se shromažďují data? jak data vyhledávat?

5 REKONSTRUKCE EVOLUČNÍ HISTORIE rekonstrukce na základě srovnávání znaků v molekulární taxonomii se používají sekvence sekvence (DNA, RNA, proteiny) se srovnávají tzv. alignmentem

6 KDE NAJÍT SEKVENCE?

7 BIOINFORMATICKÉ DATABÁZE úložiště dat (volně) dostupné pro kohokoliv snadno k nalezení lednové číslo Nucleid Acid Research (NAR)

8 LEDNOVÉ ČÍSLO NAR NUCLEOTIDE SEQUENCE DATABASES RNA SEQUENCE DATABASES PROTEIN SEQUENCE DATABASES STRUCTURE DATABASES GENOMICS DATABASES (NON-VERTEBRATE) METABOLIC AND SIGNALING PATHWAYS HUMAN AND OTHER VERTEBRATE GENOMES HUMAN GENES AND DISEASES MICROARRAY DATA AND OTHER GENE EXPRESSION DATABASES PROTEOMICS RESOURCES OTHER MOLECULAR BIOLOGY DATABASES ORGANELLE DATABASES PLANT DATABASES IMMUNOLOGICAL DATABASES

9 VLASTNOSTI DATABÁZE četnost aktualizace dat četnost aktualizace software redundance anotace dat anotace databáze

10

11

12

13

14 ...A NÁSTROJE

15 DNA DATABÁZE GenBank(NCBI) EMBL (EBI) DDJB (Japonsko)

16 MÁLO ANOTOVANÁ SEKVENCE

17 ANOTOVANÁ SEKVENCE

18

19 GENOMOVÉ DATABÁZE

20

21

22

23 PROTEINOVÉ DATABÁZE Uniprot - Swissprot + TrEMBL - 52,7 mil. sek. Swiss-prot - anotováno, ~ sekvencí GenPept - překládaný GenBank

24 UNIPROT + TREMBL AMINO ACID COMPOSITION 2.1 COMPOSITION IN PERCENT FOR THE COMPLETE DATABASE ALA (A) 8.57 GLN (Q) 3.88 LEU (L) 9.81 SER (S) 6.72 ARG (R) 5.47 GLU (E) 6.14 LYS (K) 5.30 THR (T) 5.61 ASN (N) 4.17 GLY (G) 7.08 MET (M) 2.45 TRP (W) 1.31 ASP (D) 5.28 HIS (H) 2.20 PHE (F) 4.03 TYR (Y) 3.06 CYS (C) 1.29 ILE (I) 6.00 PRO (P) 4.74 VAL (V) 6.71 ASX (B) GLX (Z) XAA (X) 0.06

25

26

27 JAK DATA VYHLEDÁVAT?

28 >ASTAKINE MKMRGVSVGVLVVAMMSGLAMAGSCNSQEPDCGPSECCLQGWMR YSTRGCAPLGEAGSSCNVFTQAPVKGFYIGMCPCRAGLVCTRPSATCQLPSQDNTLDSYY EXISTUJÍ PŘÍBUZNÉ SEKVENCE A KDE JE NAJÍT?

29 HLEDÁNÍ V DATABÁZÍCH - ALGORITMY tradiční algoritmy (Needleman-Wunsch, Smith-Waterman) pomalé pro prohledávání velkých databází používány heuristické metody - rychle vede k výsledku, který se blíží optimálnímu řešení (ale nezaručuje jej) -> pro vyšší rychlost je obětována přesnost (rule of thumb) v případě sekvenčního srovnávání se metoda vzdává jistoty nalezení optimálního alignmentu, aby v krátkém čase provedla srovnání se všemi sekvencemi v databázi (50-100x rychlejší) klasickými heuristickými metodami jsou FASTA a BLAST obě metody použitelné pro DNA i proteinové sekvence

30 FASTA metoda popsaná v 80. letech 20. století (Lipman & Pearson) rychlá, heuristická metoda (na úkor senzitivity), globální alignment zjednodušení v první fázi, sekvence rozděleny na krátké úseky program generuje všechny možné k-tuples o délce k z dané sekvence k = 1-2 pro proteiny, k = 4-6 pro DNA k-tuples jsou porovnávány s k-tuples sekvencí v databázích

31 FASTA hledání SHOD v k-tuples skórováni shod pomocí skórovací tabulky (Blosum 50) a rozšíření alignmentu (bez mezer) vysoce skórující shody vybrány vybere úseky, které budou součástí alignmentu dynamické programování pro konečný alignment (mezery)

32 BLAST BLAST = Basic Local Alignment Search Tool Altschul et al., 1990 sekvence rozděleny na slova (words) a slova skórována vůči databázi všech slov slova skórována skórovací tabulkou (Blosum 62) a jen ty, které dosáhnou předem nadefinovaného minimálního skóre (treshold) jsou dále používány slova se skóre větším než treshold nemusí nutně obsahovat jen shody ( na rozdíl od Fasty) v prvním kroku se porovnávají slova bez mezer

33 BLAST - HSP HSP - high scoring pair vyber jen taková slova, která dosahují alespoň skóre X (treshold) PEG versus PQA PEQ má s Blosum 62 skóre 15, PQA jen 12 pokud si stanovíme treshold 13, tak budeme dále hledat jen slovo PEQ

34 BLAST II takto vybráná slova jsou hledána v databázi modifikovaným Smith- Watermanem (50 x rychlejší) HSP jsou dále rozšiřovány na obě strany dokud skóre roste v posledním kroku jsou nejlépe skórující páry (HSP`s) podrobeny dynamickému programování, které produkuje výsledné skóre a alignment vzhledem k rostoucí velikosti databází je třeba algoritmus neustále modifikovat (dvě shody v okně definované velikosti) obvykle citlivější než FASTA implementován jako server na řadě míst (NCBI, EBI)

35 VERZE BLASTU blastn - hledá s DNA sekvencí (query) v DNA databázi blastp - hledá s proteinovou sekvencí v proteinové databázi blastx - hledá s DNA sekvencí (6 rámců) v proteinové databázi tblastn - hledá s proteinovou sekvencí v DNA databázi tblastx - překládaná DNA v překládané DNA databázi megablast - víc query najednou

36

37

38 BLAST - VÝBĚR databáze - DNA x protein, anotovaná x kompletní, strukturní, genomové, specializované (protilátky)... organismus datum - sekvence za poslední dva týdny skórovací tabulka - blosum 62 velikost slova low-complexity region filter - často P, D, N, E - false positive default nastavení algoritmu vhodné ve většině případů

39 BLOSUM BLOSUM 80 - tabulka vypočítaná na základě alignmentu bloku sekvencí s identitou 80 % BLOSUM 62 - tabulka vypočítaná na základě alignmentu bloku sekvencí s identitou 62 %

40 BLOSUM VERSUS PAM PAM 10 BLOSUM 90 PAM 250 BLOSUM 62 VELMI PŘÍBUZNÍ VZDÁLENĚ PŘÍBUZNÍ

41 VÝZNAMNOST NÁLEZU optimální alignment lze nalézt pro jakékoliv dvě sekvence dvě náhodné DNA sekvence = ~ 25% SI dvě náhodné proteinové sekvence = ~ 5% SI jak určit, že je alignment statisticky významný?

42 PARAMETRY VÝZNAMNOSTI P-value E-value pouze statistická významnost skóre -> biologickou relevanci záhodno ověřovat experimentálně

43 P-VALUE P-value - pravděpodobnost, že sekvence budou srovnány s nalezeným nebo vyšším skóre a zároveň nebudou příbuzné (false positive hit) P-value - pravděpodobnost, že bude skóre x nebo vyššího dosaženo náhodou pro účely výpočtu lze náhodu simulovat přeskládáváním sekvencí nebo výběrem vzorku z databáze druhá možnost lépe odpovídá realitě a poskytuje lepší výsledky (především u DNA)

44 EVD rozložení skóre lokálních alignmentů nepříbuzných sekvencí neodpovídá normálnímu rozdělení, ale rozdělení podle extrémních hodnot (EVD) při normálním rozdělení by docházelo k přeceňování významu dosažených skóre DUNDAS ET AL. BMC BIOINFORMATICS 2007

45 P-VALUE P-value (S>x) = 1-exp (-exp (-λ(x-u))), u = charakteristická hodnota = Kmn/λ m,n = délky sekvencí; K = konstanta; λ = decay factor K a λ mohou být kalkulovány z vlastností skórovací tabulky

46 E-VALUE E-value = pravděpodobnost, že bude dosaženo skóre x nebo vyššího náhodou v databázi dané velikosti E-value = P-value x N ; velikost databáze příklad: databáze o miliónu sekvencí a P-value = 10-6 cutoff (expect treshold) parametr v BLASTU - udává kolik lze průměrně očekávat false positives v databázi dané velikosti -> způsob jak vyvažovat senzitivitu a selektivitu nižší hodnota cutoff zvyšuje selektivitu, ale snižuje senzitivitu

47 E-VALUE E-value = pravděpodobnost, že bude dosaženo skóre x nebo vyššího náhodou v databázi dané velikosti E-value = P-value x N ; velikost databáze příklad: databáze o miliónu sekvencí a P-value = 10-6 E-value = 10-6 x 10 6 =1 cutoff (expect treshold) parametr v BLASTU - udává kolik lze průměrně očekávat false positives v databázi dané velikosti -> způsob jak vyvažovat senzitivitu a selektivitu nižší hodnota cutoff zvyšuje selektivitu, ale snižuje senzitivitu

48 BLAST / EVOLUČNÍ VZDÁLENOST říká nám BLAST něco o příbuznosti nalezených sekvencí? Je první hit evolučně nejpříbuznější query (hledané sekvenci)?

49 BLAST / EVOLUČNÍ VZDÁLENOST říká nám BLAST něco o příbuznosti nalezených sekvencí? Je první hit evolučně nejpříbuznější query (hledané sekvenci)? BLAST většinou nalezá příbuzné sekvence nejpříbuznější sekvence však mohou chybět v databázi lokální alignment - často skóruje nejlépe vzdálené příbuzné 7 % sekvencí E.coli mělo nejlépe skórující sekvenci mimo Bacteria

50

51

52 2JTK

53 SEQUENCE IDENTITA/HOMOLOGIE NEHOMOLOGNÍ PROTEINY ROST, 1999

54 SEQUENCE IDENTITA/HOMOLOGIE HOMOLOGNÍ PROTEINY ROST, 1999

55 SEQUENCE IDENTITA/HOMOLOGIE sekvenční identita > 35% - pravděpodobně homolog sekvenční identita = 20-35% ( twilight zone ; Doolittle) - může být homolog sekvenční identita < 20% - midnight zone (Rost) - sekvence zcela nedostatečná k určení homologie

56 SANDER ET AL., PREPRINT Average sequence identity of random alignments % Average sequence identity of remote homologues %

57 SSEARCH pokud máte moře času nebo počítačový klastr nebo jste zoufalí rigorózní Smith-Waterman - local alignment v databázi

58 DALŠÍ METODY HLEDÁNÍ V DATABÁZÍCH profilové metody HMM modely

59 PROFILY modifikují skórovací tabulky specificky pro skupiny proteinů a pozici v alignmentu (např. globiny) pro každou pozici v alignmentu jsou generovány specifická skóre jak pro záměnu za jakoukoliv aa, tak pro inzerci nebo deleci Prof (pos,aa) = Σtype N(pos,type) x S(type, aa) x 10 N(pos,type) = podíl výskytu aa x na pozici y S(type, aa) = skóre skórovací tabulky pro zaměňovaný pár

60 PŘÍKLAD PROFILU v alignmentu globinů se na pozici 3 vyskytuje 3x Ala, 6x Val, 1x Ile, používáme tabulku Blosum 62 jaké bude profilové skóre pro výskyt Ile a His? N(x,A) = 0.3, N(x,V) = 0.6, N(x, I) = 0.1 S(A,I) = -1, S(V,I) = 3, S(I,I) = 4 S(A,H) = -2, S(V,H) = -3, S(I,H) = -3 Prof (x, I) = 0.3 x x x 4 = 2.1 x 10 (v profilu) = 21 ( -1, 3, 4) Prof (x, H) = 0.3 x x x -3 = -2.7 x 10 = -27 (-2, -3, -3)

61 PSI-BLAST PSI-BLAST = Position Specific Iterative Blast Altschul et al., 1997 profilová metoda, používá Position Specific Scoring Matrix (PSSM) v prvním kole klasický BLAST, z vysoko skórujících alignmentů je generována PSSM v dalším kole hledání je už použita nová matrice a následně znovu generována nová PSSM opakováno libovolně dlouho (až ke konvergenci) benchmark metoda

62 HMM HMM = Hidden Markov Model profilová metoda, používána při rozhodování, zda protein spadá do jisté skupiny proteinů, typicky pro sekvence s nízkou %SI velmi citlivá metoda, která vytváří statistický model pro definovanou skupinu sekvencí na základě tréninku na sekvencích patřících do jedné skupiny (globiny) generuje pravděpodobnost nejen pro jednotlivé záměny a inzerce a delece, ale i pro přechody mezi nima dovede do modelu zahrnout i aminokyseliny, které se v tréninkové skupině nevyskytují alignment s největší pravděpodobností je optimální posuzuje jak dobře daná sekvence odpovídá modelu

63 HMM

64 SHRNUTÍ databáze by měly být pravidelně updatovány přehled dostupných biologických databází vždy v lednovém čísle NAR řada velmi specializovaných databází hledání v databázích povětšinou heuristickými metodami standard dnes BLAST nutno hodnotit statistickou významnost nálezu citlivější metodou PSI-Blast nebo HMM metody

Co se o sobě dovídáme z naší genetické informace

Co se o sobě dovídáme z naší genetické informace Genomika a bioinformatika Co se o sobě dovídáme z naší genetické informace Jan Pačes, Mgr, Ph.D Ústav molekulární genetiky AVČR, CZECH FOBIA (Free and Open Bioinformatics Association) hpaces@img.cas.cz

Více

Aminokyseliny příručka pro učitele. Obecné informace: Téma otevírá kapitolu Bílkoviny, která svým rozsahem překračuje rámec jedné vyučovací hodiny.

Aminokyseliny příručka pro učitele. Obecné informace: Téma otevírá kapitolu Bílkoviny, která svým rozsahem překračuje rámec jedné vyučovací hodiny. Obecné informace: Aminokyseliny příručka pro učitele Téma otevírá kapitolu Bílkoviny, která svým rozsahem překračuje rámec jedné vyučovací hodiny. Navazující učivo Před probráním tématu Aminokyseliny probereme

Více

Využití strojového učení k identifikaci protein-ligand aktivních míst

Využití strojového učení k identifikaci protein-ligand aktivních míst Využití strojového učení k identifikaci protein-ligand aktivních míst David Hoksza, Radoslav Krivák SIRET Research Group Katedra softwarového inženýrství, Matematicko-fyzikální fakulta Karlova Univerzita

Více

V. letní škola metod molekulární biologie nukleových kyselin a genomiky 16. - 20. 6. 2014. Ústav morfologie, fyziologie a genetiky zvířat AF MENDELU

V. letní škola metod molekulární biologie nukleových kyselin a genomiky 16. - 20. 6. 2014. Ústav morfologie, fyziologie a genetiky zvířat AF MENDELU V. letní škola metod molekulární biologie nukleových kyselin a genomiky 16. - 20. 6. 2014 Ústav morfologie, fyziologie a genetiky zvířat AF MENDELU Zemědělská 1, Budova A, 4. patro (učebny dle programu)

Více

E-infrastruktura CESNET - partner výzkumné infrastruktury pro biologická data ELIXIR CZ

E-infrastruktura CESNET - partner výzkumné infrastruktury pro biologická data ELIXIR CZ E-infrastruktura CESNET - partner výzkumné infrastruktury pro biologická data ELIXIR CZ Life Science - od molekul k systému Slovník komponent Gramatika (interakce) Souvislosti a sítě (diagramy ) Atlas

Více

Bioinformatika. hledání významu biologických dat. Marian Novotný. Friday, April 24, 15

Bioinformatika. hledání významu biologických dat. Marian Novotný. Friday, April 24, 15 Bioinformatika hledání významu biologických dat Marian Novotný Bioinformatika sběr biologických dat archivace biologických dat organizace biologických dat interpretace biologických dat 2 Biologové sbírají

Více

Výuka genetiky na Přírodovědecké fakultě UK v Praze

Výuka genetiky na Přírodovědecké fakultě UK v Praze Výuka genetiky na Přírodovědecké fakultě UK v Praze Studium biologie na PřF UK v Praze Bakalářské studijní programy / obory Biologie Biologie ( duhový bakalář ) Ekologická a evoluční biologie ( zelený

Více

Pravděpodobnost v závislosti na proměnné x je zde modelován pomocí logistického modelu. exp x. x x x. log 1

Pravděpodobnost v závislosti na proměnné x je zde modelován pomocí logistického modelu. exp x. x x x. log 1 Logistická regrese Menu: QCExpert Regrese Logistická Modul Logistická regrese umožňuje analýzu dat, kdy odezva je binární, nebo frekvenční veličina vyjádřená hodnotami 0 nebo 1, případně poměry v intervalu

Více

Doprovodný materiál k práci s přípravným textem Biologické olympiády 2014/2015 pro soutěžící a organizátory kategorie B

Doprovodný materiál k práci s přípravným textem Biologické olympiády 2014/2015 pro soutěžící a organizátory kategorie B Doprovodný materiál k práci s přípravným textem Biologické olympiády 2014/2015 pro soutěžící a organizátory kategorie B Níže uvedené komentáře by měly pomoci soutěžícím z kategorie B ke snazší orientaci

Více

MATEMATICKÁ BIOLOGIE

MATEMATICKÁ BIOLOGIE INSTITUT BIOSTATISTIKY A ANALÝZ Lékařská a Přírodovědecká fakulta, Masarykova univerzita MATEMATICKÁ BIOLOGIE Přírodovědecká fakulta Masarykova univerzita, Brno Studijní obor Matematická biologie Masarykova

Více

Molekulární základ dědičnosti

Molekulární základ dědičnosti Molekulární základ dědičnosti Dědičná informace je zakódována v deoxyribonukleové kyselině, která je uložena v jádře buňky v chromozómech. Zlomovým objevem pro další rozvoj molekulární genetiky bylo odhalení

Více

VÝUKA studentů celkem 3 000 (bakaláři + magistři + doktorandi); 72 profesorů, 120 docentů

VÝUKA studentů celkem 3 000 (bakaláři + magistři + doktorandi); 72 profesorů, 120 docentů založena roku 1920 centrum výuky a výzkumu rozpočet v roce 2013 cca 1,114 miliardy Kč (zhruba 1:1 státní dotace a grantové prostředky) - z toho biologie má asi 1/3 (i v dalších parametrech) VÝUKA studentů

Více

ÚSTAV FYZIKÁLNÍ BIOLOGIE JIHOČESKÁ UNIVERZITA V ČESKÝCH BUDĚJOVICÍCH

ÚSTAV FYZIKÁLNÍ BIOLOGIE JIHOČESKÁ UNIVERZITA V ČESKÝCH BUDĚJOVICÍCH ÚSTAV FYZIKÁLNÍ BIOLOGIE JIHOČESKÁ UNIVERZITA V ČESKÝCH BUDĚJOVICÍCH ZPRÁVA O UKONČENÍ PROJEKTU Projekt Název projektu: Impact of host ecology on metabolic capacity of Sodalis allied symbiotic bacteria

Více

PRODUKTY. Tovek Tools

PRODUKTY. Tovek Tools jsou desktopovou aplikací určenou k vyhledávání informací, tvorbě různých typů analýz a vytváření přehledů a rešerší. Jsou vhodné pro práci i s velkým objemem textových dat z různorodých informačních zdrojů.

Více

Počítačová chemie. výpočetně náročné simulace chemických a biomolekulárních systémů. Zora Střelcová

Počítačová chemie. výpočetně náročné simulace chemických a biomolekulárních systémů. Zora Střelcová Počítačová chemie výpočetně náročné simulace chemických a biomolekulárních systémů Zora Střelcová Národní centrum pro výzkum biomolekul, Masarykova univerzita, Kotlářská 2, 611 37 Brno, Česká Republika

Více

Úvodem Dříve les než stromy 3 Operace s maticemi

Úvodem Dříve les než stromy 3 Operace s maticemi Obsah 1 Úvodem 13 2 Dříve les než stromy 17 2.1 Nejednoznačnost terminologie 17 2.2 Volba metody analýzy dat 23 2.3 Přehled vybraných vícerozměrných metod 25 2.3.1 Metoda hlavních komponent 26 2.3.2 Faktorová

Více

Experimentální systém pro WEB IR

Experimentální systém pro WEB IR Experimentální systém pro WEB IR Jiří Vraný Školitel: Doc. RNDr. Pavel Satrapa PhD. Problematika disertační práce velmi stručný úvod WEB IR information retrieval from WWW, vyhledávání na webu Vzhledem

Více

Uživatelská podpora v prostředí WWW

Uživatelská podpora v prostředí WWW Uživatelská podpora v prostředí WWW Jiří Jelínek Katedra managementu informací Fakulta managementu Jindřichův Hradec Vysoká škola ekonomická Praha Úvod WWW obsáhlost obsahová i formátová pestrost dokumenty,

Více

Inovace studia molekulární a buněčné biologie reg. č. CZ.1.07/2.2.00/07.0354

Inovace studia molekulární a buněčné biologie reg. č. CZ.1.07/2.2.00/07.0354 I n v e s t i c e d o r o z v o j e v z d ě l á v á n í Inovace studia molekulární a buněčné biologie reg. č. CZ.1.07/2.2.00/07.0354 Tento projekt je spolufinancován Evropským sociálním fondem a státním

Více

Výukový materiál zpracován v rámci projektu EU peníze školám Registrační číslo projektu: CZ.1.07/1.5.00/34.0996

Výukový materiál zpracován v rámci projektu EU peníze školám Registrační číslo projektu: CZ.1.07/1.5.00/34.0996 Výukový materiál zpracován v rámci projektu EU peníze školám Registrační číslo projektu: CZ.1.07/1.5.00/34.0996 Šablona: III/2 č. materiálu: VY_32_INOVACE_CHE_413 Jméno autora: Mgr. Alena Krejčíková Třída/ročník:

Více

ROZPOZNÁVÁNÍ S MARKOVSKÝMI MODELY

ROZPOZNÁVÁNÍ S MARKOVSKÝMI MODELY ROZPOZNÁVÁNÍ S MARKOVSKÝMI MODELY Václav Hlaváč Fakulta elektrotechnická ČVUT v Praze katedra kybernetiky, Centrum strojového vnímání hlavac@fel.cvut.cz, http://cmp.felk.cvut.cz/ hlavac 1/31 PLÁN PŘEDNÁŠKY

Více

Národní centrum pro výzkum biomolekul & MetaCentrum

Národní centrum pro výzkum biomolekul & MetaCentrum Masarykova Univerzita Národní centrum pro výzkum biomolekul Národní centrum pro výzkum biomolekul & Petr Kulhánek kulhanek@chemi.muni.cz Národní centrum pro výzkum biomolekul, Masarykova Univerzita Přírodovědecká

Více

IDENTIFIKACE ORGANISMŮ POMOCÍ ANALÝZY NUKLEOTIDOVÝCH DENZITNÍCH VEKTORŮ

IDENTIFIKACE ORGANISMŮ POMOCÍ ANALÝZY NUKLEOTIDOVÝCH DENZITNÍCH VEKTORŮ VYSOKÉ UČENÍ TECHNICKÉ V BRNĚ BRNO UNIVERSITY OF TECHNOLOGY FAKULTA ELEKTROTECHNIKY A KOMUNIKAČNÍCH TECHNOLOGIÍ ÚSTAV BIOMEDICÍNSKÉHO INŽENÝRSTVÍ FACULTY OF ELECTRICAL ENGINEERING AND COMMUNICATION DEPARTMENT

Více

Bílkoviny. Charakteristika a význam Aminokyseliny Peptidy Struktura bílkovin Významné bílkoviny

Bílkoviny. Charakteristika a význam Aminokyseliny Peptidy Struktura bílkovin Významné bílkoviny Bílkoviny harakteristika a význam Aminokyseliny Peptidy Struktura bílkovin Významné bílkoviny 1) harakteristika a význam Makromolekulární látky složené z velkého počtu aminokyselinových zbytků V tkáních

Více

Lodish et al, Molecular Cell Biology, 4-6 vydání Alberts et al, Molecular Biology of the Cell, 4 vydání

Lodish et al, Molecular Cell Biology, 4-6 vydání Alberts et al, Molecular Biology of the Cell, 4 vydání Lodish et al, Molecular Cell Biology, 4-6 vydání Alberts et al, Molecular Biology of the Cell, 4 vydání http://web.natur.cuni.cz/~zdenap/zdenateachingnf.html CHEMICKÉ SLOŽENÍ BUŇKY BUŇKA: 99 % C, H, N,

Více

CLP ANALYSIS OF MOLECULAR MARKERS DIGITAL IMAGE ANALYSIS OF ELECTROPHOEROGRAMS CZECH VERSION

CLP ANALYSIS OF MOLECULAR MARKERS DIGITAL IMAGE ANALYSIS OF ELECTROPHOEROGRAMS CZECH VERSION CLP ANALYSIS OF MOLECULAR MARKERS DIGITAL IMAGE ANALYSIS OF ELECTROPHOEROGRAMS CZECH VERSION DIGITÁLNÍ OBRAZOVÁ ANALÝZA ELEKTROFORETICKÝCH GELŮ *** Vyhodnocování získaných elektroforeogramů: Pro vyhodnocování

Více

Výuka genetiky na Přírodovědecké fakultě MU

Výuka genetiky na Přírodovědecké fakultě MU MASARYKOVA UNIVERZITA Přírodovědecká fakulta Výuka genetiky na Přírodovědecké fakultě MU Jiří Doškař Ústav experimentální biologie, Oddělení genetiky a molekulární biologie 1 V akademickém roce 1964/1965

Více

Systém monitorování technologického procesu v Teplárnách Varšava (Elektrociepłownie Warszawskie S.A.)

Systém monitorování technologického procesu v Teplárnách Varšava (Elektrociepłownie Warszawskie S.A.) R. T. S. cs, spol. s r. o. Novinářská 1113/3 709 00 Ostrava IČO: 18051367 DIČ: CZ18051367 Tel.: +420 597450219 Fax: +420 597450247 E-mail: info@rtscs.cz URL: www.rtscs.cz Společnost je zapsána v OR KS

Více

Molekulární diagnostika infekční bronchitidy v České republice a na Slovensku. Richard J W Currie

Molekulární diagnostika infekční bronchitidy v České republice a na Slovensku. Richard J W Currie Molekulární diagnostika infekční bronchitidy v České republice a na Slovensku Richard J W Currie Virus infekční bronchitidy RNA (nukleová kyselina) uvnitř Proteiny (spike proteiny S1 a S2) na vnější straně

Více

FLUORESCENČNÍ MIKROSKOP

FLUORESCENČNÍ MIKROSKOP FLUORESCENČNÍ MIKROSKOP na gymnáziu Pierra de Coubertina v Táboře Pavla Trčková, kabinet Biologie, GPdC Tábor Co je fluorescence Fluorescence je jev spočívající v tom, že některé látky (fluorofory) po

Více

Testování statistických hypotéz. Ing. Michal Dorda, Ph.D.

Testování statistických hypotéz. Ing. Michal Dorda, Ph.D. Testování statistických hypotéz Ing. Michal Dorda, Ph.D. Testování normality Př. : Při simulaci provozu na křižovatce byla získána data o mezerách mezi přijíždějícími vozidly v [s]. Otestujte na hladině

Více

ÚVOD DO BIOCHEMIE. Dělení : 1)Popisná = složení org., struktura a vlastnosti látek 2)Dynamická = energetické změny

ÚVOD DO BIOCHEMIE. Dělení : 1)Popisná = složení org., struktura a vlastnosti látek 2)Dynamická = energetické změny BIOCHEMIE 1 ÚVOD DO BIOCHEMIE BCH zabývá se chemickými procesy v organismu a chemickým složením živých organismů Biologie: bios = život + logos = nauka Biochemie: bios = život + chemie Dělení : Chemie

Více

CADASIL. H. Vlášková, M. Boučková Hnízdová, A. Loužecká, M. Hřebíček, R. Matěj, M. Elleder

CADASIL. H. Vlášková, M. Boučková Hnízdová, A. Loužecká, M. Hřebíček, R. Matěj, M. Elleder CADASIL analýza mutací v genu NOTCH3 H. Vlášková, M. Boučková Hnízdová, A. Loužecká, M. Hřebíček, R. Matěj, M. Elleder Ústav dědičných metabolických poruch 1. LF UK a VFN Oddělení patologie a nár. ref.

Více

PROTEIN PROFILE OF TENEBRIO MOLITOR

PROTEIN PROFILE OF TENEBRIO MOLITOR PROTEIN PROFILE OF TENEBRIO MOLITOR Bednářová M. 1, Adam V. 2, Jelen F. 3, Borkovcová M. 4 1 Institute of Service of information technology, Mendel University in Brno, Zemědělská 1, 613 00 Brno, Czech

Více

SEXUALITA UŽIVATELŮ MARIHUANY OČIMA PARTNEREK

SEXUALITA UŽIVATELŮ MARIHUANY OČIMA PARTNEREK SEXUALITA UŽIVATELŮ MARIHUANY OČIMA PARTNEREK Mgr. Alexandra HROUZKOVÁ Katedra psychologie FFUK, Praha Prof. PhDr. Petr WEISS, PhD. Sexuologický ústav VFN a 1.LF UK, Praha ÚVODEM Konopné drogy jsou po

Více

Strom života. Cíle. Stručná anotace

Strom života. Cíle. Stručná anotace Předmět: Doporučený ročník: Vazba na ŠVP: Biologie 1. ročník Úvod do taxonomie Cíle Studenti zařadí člověka do příslušných taxonů taxonomického systému. Studenti se seznámí s principem fylogenetického

Více

1. Základy teorie přenosu informací

1. Základy teorie přenosu informací 1. Základy teorie přenosu informací Úvodem citát o pojmu informace Informace je název pro obsah toho, co se vymění s vnějším světem, když se mu přizpůsobujeme a působíme na něj svým přizpůsobováním. N.

Více

Možnosti využití technologie DNA microarrays v predikci odpovědi na neoadjuvantní terapii u pacientů s karcinomem jícnu

Možnosti využití technologie DNA microarrays v predikci odpovědi na neoadjuvantní terapii u pacientů s karcinomem jícnu Možnosti využití technologie DNA microarrays v predikci odpovědi na neoadjuvantní terapii u pacientů s karcinomem jícnu Srovnal J. 1, Cincibuch J. 2, Cwierkta K. 2, Melichar B. 2, Aujeský R. 3, Vrba R.

Více

Pylové alergeny. Workshop 2007. 17. března 2007, Praha

Pylové alergeny. Workshop 2007. 17. března 2007, Praha Pylové alergeny Workshop 2007 17. března 2007, Praha Pylové alergeny Workshop 2007 17. března 2007 o. s. pro alergiky, astmatiky a ekzematiky Máša Karlovo náměstí 7, 120 00 Praha 2 Tel: 222162321, mobil:

Více

Vývoj moderních technologií při vyhledávání. Patrik Plachý SEFIRA spol. s.r.o. plachy@sefira.cz

Vývoj moderních technologií při vyhledávání. Patrik Plachý SEFIRA spol. s.r.o. plachy@sefira.cz Vývoj moderních technologií při vyhledávání Patrik Plachý SEFIRA spol. s.r.o. plachy@sefira.cz INFORUM 2007: 13. konference o profesionálních informačních zdrojích Praha, 22. - 24.5. 2007 Abstrakt Vzhledem

Více

AMINOKYSELINOVÝCH MUTACÍ NA STABILITU PROTEINU

AMINOKYSELINOVÝCH MUTACÍ NA STABILITU PROTEINU VYSOKÉ UČENÍ TECHNICKÉ V BRNĚ BRNO UNIVERSITY OF TECHNOLOGY FAKULTA INFORMAČNÍCH TECHNOLOGIÍ ÚSTAV INFORMAČNÍCH SYSTÉMŮ FACULTY OF INFORMATION TECHNOLOGY DEPARTMENT OF INFORMATION SYSTEMS STROJOVÉ UČENÍ

Více

Chyby spektrometrických metod

Chyby spektrometrických metod Chyby spektrometrických metod Náhodné Soustavné Hrubé Správnost výsledku Přesnost výsledku Reprodukovatelnost Opakovatelnost Charakteristiky stanovení 1. Citlivost metody - směrnice kalibrační křivky 2.

Více

Střední odborná škola stavební Karlovy Vary Sabinovo náměstí 16, 360 09 Karlovy Vary Autor: Ing. Hana Šmídová Název materiálu:

Střední odborná škola stavební Karlovy Vary Sabinovo náměstí 16, 360 09 Karlovy Vary Autor: Ing. Hana Šmídová Název materiálu: Název školy: Střední odborná škola stavební Karlovy Vary Sabinovo náměstí 16, 360 09 Karlovy Vary Autor: Ing. Hana Šmídová Název materiálu: VY_32_INOVACE_01_ACCESS_P2 Číslo projektu: CZ 1.07/1.5.00/34.1077

Více

Národní informační středisko pro podporu kvality

Národní informační středisko pro podporu kvality Národní informační středisko pro podporu kvality Nestandardní regulační diagramy J.Křepela, J.Michálek REGULAČNÍ DIAGRAM PRO VŠECHNY INDIVIDUÁLNÍ HODNOTY xi V PODSKUPINĚ V praxi se někdy setkáváme s požadavkem

Více

Mutace s dobrou prognózou, mutace se špatnou prognózou omezené možnosti biologické léčby pro onkologické pacienty

Mutace s dobrou prognózou, mutace se špatnou prognózou omezené možnosti biologické léčby pro onkologické pacienty Mutace s dobrou prognózou, mutace se špatnou prognózou omezené možnosti biologické léčby pro onkologické pacienty J.Berkovcová, M.Dziechciarková, M.Staňková, A.Janošťáková, D.Dvořáková, M.Hajdúch Laboratoř

Více

Informační a komunikační technologie. Informační a komunikační technologie

Informační a komunikační technologie. Informační a komunikační technologie Oblast Předmět Období Časová dotace Místo realizace Charakteristika předmětu Průřezová témata Informační a komunikační technologie Informační a komunikační technologie 5. 6. ročník 1 hodina týdně počítačová

Více

Ekologie tropických lesů a jejich obyvatel

Ekologie tropických lesů a jejich obyvatel Ekologie tropických lesů a jejich obyvatel Vojtěch Novotný Biologické centrum AV ČR a Přírodovědecká fakulta Jihočeské univerzity Ekologický problém č. 1: Jaký je mechanismus koexistence tisíců druhů

Více

Ě ÁÁ Ú é é ý ů ý ů é ý ů é é ú Ž ý ů é ů é é Ě ÁÁ Ú é Ý ž ý ž ý ý ů ž ů ň é Ž ý Ž ů ý é é é é ý ž Í Ě ÁÁ Ú é é ň é Ž ý ž Ž Í ý é ý Í ů ý ý ý é ý é ý é ň Ž Ž Ě ÁÁ Ú é é ý Ý é é ý Ž Í Í é ž Í Ž Ě ÁÁ Ú é

Více

PRVNÍ ELASTICKÝ INFORMAČNÍ SYSTÉM : QI

PRVNÍ ELASTICKÝ INFORMAČNÍ SYSTÉM : QI PRVNÍ ELASTICKÝ INFORMAČNÍ SYSTÉM : QI Cyril Klimeš a) Jan Melzer b) a) Ostravská univerzita, katedra informatiky a počítačů, 30. dubna 22, 701 03 Ostrava, ČR E-mail: cyril.klimes@osu.cz b) DC Concept

Více

Indexace pro souborová uložiště a Vyhledávací centrum

Indexace pro souborová uložiště a Vyhledávací centrum Indexace pro souborová uložiště a Vyhledávací centrum Obsah I. Úvod... 2 II. Cíl dokumentu... 2 III. Fáze projektu... 2 IV. Popis jednotlivých fází projektu... 2 1. Fáze 1. - Analýza... 2 2. Fáze 2. -

Více

Vyšší odborná škola a Střední škola,varnsdorf, příspěvková organizace. Šablona 4 VY 32 INOVACE 0101 0304

Vyšší odborná škola a Střední škola,varnsdorf, příspěvková organizace. Šablona 4 VY 32 INOVACE 0101 0304 Vyšší odborná škola a Střední škola,varnsdorf, příspěvková organizace Šablona 4 VY 32 INOVACE 0101 0304 VÝUKOVÝ MATERIÁL Identifikační údaje školy Číslo projektu Název projektu Číslo a název šablony Autor

Více

ROZDÍLY V NÁVRZÍCH RELAČNÍCH A OBJEKTOVÝCH DATABÁZÍ A JEJICH DŮSLEDKY PRO TRANSFORMACI MODELŮ

ROZDÍLY V NÁVRZÍCH RELAČNÍCH A OBJEKTOVÝCH DATABÁZÍ A JEJICH DŮSLEDKY PRO TRANSFORMACI MODELŮ ROZDÍLY V NÁVRZÍCH RELAČNÍCH A OBJEKTOVÝCH DATABÁZÍ A JEJICH DŮSLEDKY PRO TRANSFORMACI MODELŮ RELATIONAL AND OBJECT DATABASES DESIGN DIFFERENCES AND IT S IMPLICATIONS TO MODEL TRANSFORMATION Vít Holub

Více

Modely vyhledávání informací 4 podle technologie. 1) Booleovský model. George Boole 1815 1864. Aplikace booleovské logiky

Modely vyhledávání informací 4 podle technologie. 1) Booleovský model. George Boole 1815 1864. Aplikace booleovské logiky Modely vyhledávání informací 4 podle technologie 1) Booleovský model 1) booleovský 2) vektorový 3) strukturní 4) pravděpodobnostní a další 1 dokumenty a dotazy jsou reprezentovány množinou indexových termů

Více

1. cvičení 4ST201. Základní informace: Vyučující: Obsah: Informace o kurzu Popisná statistika Úvod do SASu

1. cvičení 4ST201. Základní informace: Vyučující: Obsah: Informace o kurzu Popisná statistika Úvod do SASu cvičící 1. cvičení 4ST201 Informace o kurzu Popisná statistika Úvod do SASu Obsah: Vysoká škola ekonomická 1 Vyučující: Základní informace:» Konzultační hodiny: pátek 9:00 11:00» Místnost: JM317» Email:

Více

RNA interference (RNAi)

RNA interference (RNAi) Liběchov, 29. 11. 2013 RNA interference (RNAi) post-transkripční umlčení genové exprese přirozený mechanismus regulace genové exprese a genomové stability obranný antivirový mechanismus konzervovaný mechanismus

Více

Biochemie I. Aminokyseliny a peptidy

Biochemie I. Aminokyseliny a peptidy Biochemie I Aminokyseliny a peptidy Aminokyseliny a peptidy (vlastnosti, stanovení a reakce) AMINOKYSELINY Když se řekne AK ( -COOH, -NH 2 nebo -NH-) prostorový vztah aminoskupiny a karboxylové skupiny:

Více

Biomarkery - diagnostika a prognóza nádorových onemocnění

Biomarkery - diagnostika a prognóza nádorových onemocnění Biomarkery - diagnostika a prognóza nádorových onemocnění O. Topolčan,M.Pesta, J.Kinkorova, R. Fuchsová Fakultní nemocnice a Lékařská fakulta Plzeň CZ.1.07/2.3.00/20.0040 a IVMZČR Témata přednášky Přepdpoklady

Více

NÁHODNÉ VELIČINY JAK SE NÁHODNÁ ČÍSLA PŘEVEDOU NA HODNOTY NÁHODNÝCH VELIČIN?

NÁHODNÉ VELIČINY JAK SE NÁHODNÁ ČÍSLA PŘEVEDOU NA HODNOTY NÁHODNÝCH VELIČIN? NÁHODNÉ VELIČINY GENEROVÁNÍ SPOJITÝCH A DISKRÉTNÍCH NÁHODNÝCH VELIČIN, VYUŽITÍ NÁHODNÝCH VELIČIN V SIMULACI, METODY TRANSFORMACE NÁHODNÝCH ČÍSEL NA HODNOTY NÁHODNÝCH VELIČIN. JAK SE NÁHODNÁ ČÍSLA PŘEVEDOU

Více

Experimentáln. lní toků ve VK EMO. XXX. Dny radiační ochrany Liptovský Ján 10.11.-14.11.2008 Petr Okruhlica, Miroslav Mrtvý, Zdenek Kopecký. www.vf.

Experimentáln. lní toků ve VK EMO. XXX. Dny radiační ochrany Liptovský Ján 10.11.-14.11.2008 Petr Okruhlica, Miroslav Mrtvý, Zdenek Kopecký. www.vf. Experimentáln lní měření průtok toků ve VK EMO XXX. Dny radiační ochrany Liptovský Ján 10.11.-14.11.2008 Petr Okruhlica, Miroslav Mrtvý, Zdenek Kopecký Systém měření průtoku EMO Měření ve ventilačním komíně

Více

Systémy pro podporu rozhodování. Modelování a analýza

Systémy pro podporu rozhodování. Modelování a analýza Systémy pro podporu rozhodování Modelování a analýza 1 Připomenutí obsahu minulé přednášky Datové sklady, přístup, analýza a vizualizace Povaha a zdroje dat (data, informace, znalosti a interní, externí,

Více

PPM umožňuje: PPM napomáhá: Systém je postaven na čtyřech základních pilířích, vedoucích k efektivnímu vývoji a optimalizaci portfolia:

PPM umožňuje: PPM napomáhá: Systém je postaven na čtyřech základních pilířích, vedoucích k efektivnímu vývoji a optimalizaci portfolia: Solutions s.r.o. PPM umožňuje: Komplexní analýzu vývoje portfolia Strategické řízení Evidenci projektů Evidenci projektových a souvisejících dat Závislost procesů, podpora workflow definovaná událost

Více

Zpráva o zhotoveném plnění

Zpráva o zhotoveném plnění Zpráva o zhotoveném plnění Aplikace byla vytvořena v souladu se Smlouvou a na základě průběžných konzultací s pověřenými pracovníky referátu Manuscriptorium. Toto je zpráva o zhotoveném plnění. Autor:

Více

Interakce proteinu p53 s genomovou DNA v kontextu chromatinu glioblastoma buněk

Interakce proteinu p53 s genomovou DNA v kontextu chromatinu glioblastoma buněk MASARYKOVA UNIVERZITA V BRNĚ Přírodovědecká fakulta Ústav experimentální biologie Oddělení genetiky a molekulární biologie Interakce proteinu p53 s genomovou DNA v kontextu chromatinu glioblastoma buněk

Více

UNIVERZITA OBRANY Fakulta ekonomiky a managementu. Aplikace STAT1. Výsledek řešení projektu PRO HORR2011 a PRO GRAM2011 3. 11.

UNIVERZITA OBRANY Fakulta ekonomiky a managementu. Aplikace STAT1. Výsledek řešení projektu PRO HORR2011 a PRO GRAM2011 3. 11. UNIVERZITA OBRANY Fakulta ekonomiky a managementu Aplikace STAT1 Výsledek řešení projektu PRO HORR2011 a PRO GRAM2011 Jiří Neubauer, Marek Sedlačík, Oldřich Kříž 3. 11. 2012 Popis a návod k použití aplikace

Více

Lokální definice (1) plocha-kruhu

Lokální definice (1) plocha-kruhu Lokální definice (1) syntaxe: (local (seznam definic) výraz) definice jsou dostupné pouze uvnitř příkazu local příklad: (local ( (define Pi 3.1415926) (define (plocha-kruhu r) (* Pi r r)) ) (plocha-kruhu

Více

Vstupní požadavky, doporučení a metodické pokyny

Vstupní požadavky, doporučení a metodické pokyny Název modulu: Základy PHP Označení: C9 Stručná charakteristika modulu Modul je orientován na tvorbu dynamických stánek aktualizovaných podle kontextu volání. Jazyk PHP umožňuje velmi jednoduchým způsobem

Více

Gymnázium Vysoké Mýto nám. Vaňorného 163, 566 01 Vysoké Mýto

Gymnázium Vysoké Mýto nám. Vaňorného 163, 566 01 Vysoké Mýto Gymnázium Vysoké Mýto nám. Vaňorného 163, 566 01 Vysoké Mýto SUBSTITUČNÍ DERIVÁTY KARBOXYLOVÝCH O KYSELIN R C O X karboxylových kyselin - substituce na vedlejším uhlovodíkovém řetězci aminokyseliny - hydroxykyseliny

Více

Návrh a prototypová implementace databáze pro

Návrh a prototypová implementace databáze pro Návrh a prototypová implementace databáze pro snadnější práci se strukturami nukleových kyselin Bc. Ondřej Čečák Fakulta elektrotechnická České vysoké učení technické v Praze 10. června 2011 10. června

Více

OZD. 2. ledna 2013. Logický (Objekty, atributy,...) objekty stejného typu.

OZD. 2. ledna 2013. Logický (Objekty, atributy,...) objekty stejného typu. OZD 2. ledna 2013 1 Paměti Hierarchie: Registry Cache (nejsou viditelné) Primární pamět (RAM) Pamět druhé úrovně (Disky, trvalá úložiště), pomalá Pamět třetí úrovně (CD, pásky) 1.1 Paměti druhé úrovně

Více

OptimiDoc dokáže takové dokumenty zpracovat a distribuovat napříč firmou.

OptimiDoc dokáže takové dokumenty zpracovat a distribuovat napříč firmou. Automatizujte zpracování a distribuci dokumentů do vašich firemních procesů! Nemáte kontrolu nad stovkami papírových dokumentů, které přichází do vaší firmy? OptimiDoc dokáže takové dokumenty zpracovat

Více

Národníinformačnístředisko pro podporu jakosti

Národníinformačnístředisko pro podporu jakosti Národníinformačnístředisko pro podporu jakosti OVĚŘOVÁNÍ PŘEDPOKLADU NORMALITY Doc. Ing. Eva Jarošová, CSc. Ing. Jan Král Používané metody statistické testy: Chí-kvadrát test dobré shody Kolmogorov -Smirnov

Více

Monitorovací systém teplot

Monitorovací systém teplot Odbor nákupu VÁŠ DOPIS ZN / ZE DNE NAŠE ZNAČKA 231-4/12-KN VYŘIZUJE / LINKA NOVÁK/588443184 DATUM 7/5/12 Veřejná zakázka malého rozsahu na dodání a instalaci Monitorovacího systému teplot Fakultní nemocnice

Více

Statistické metody uţívané při ověřování platnosti hypotéz

Statistické metody uţívané při ověřování platnosti hypotéz Statistické metody uţívané při ověřování platnosti hypotéz Hypotéza Domněnka, předpoklad Nejčastěji o rozdělení, středních hodnotách, závislostech, Hypotézy ve vědeckém výzkumu pracovní, věcné hypotézy

Více

Microsoft Office. Excel vyhledávací funkce

Microsoft Office. Excel vyhledávací funkce Microsoft Office Excel vyhledávací funkce Karel Dvořák 2011 Vyhledávání v tabulkách Vzhledem ke skutečnosti, že Excel je na mnoha pracovištích používán i jako nástroj pro správu jednoduchých databází,

Více

Optimalizaci aplikací. Ing. Martin Pavlica

Optimalizaci aplikací. Ing. Martin Pavlica Optimalizaci aplikací Ing. Martin Pavlica Vize: Aplikace v dnešním světě IT Ze všech částí IT jsou aplikace nejblíže businessu V elektronizovaném světě významným způsobem podporují business, ten se na

Více

DUM č. 3 v sadě. 37. Bi-2 Cytologie, molekulární biologie a genetika

DUM č. 3 v sadě. 37. Bi-2 Cytologie, molekulární biologie a genetika projekt GML Brno Docens DUM č. 3 v sadě 37. Bi-2 Cytologie, molekulární biologie a genetika Autor: Martin Krejčí Datum: 02.06.2014 Ročník: 6AF, 6BF Anotace DUMu: chromatin - stavba, organizace a struktura

Více

Biostatistika Cvičení 7

Biostatistika Cvičení 7 TEST Z TEORIE 1. Střední hodnota pevně zvolené náhodné veličiny je a) náhodná veličina, b) konstanta, c) náhodný jev, d) výběrová charakteristika. 2. Výběrový průměr je a) náhodná veličina, b) konstanta,

Více

Skrytá tvář laboratorních metod? J. Havlasová, Interimun s.r.o.

Skrytá tvář laboratorních metod? J. Havlasová, Interimun s.r.o. Skrytá tvář laboratorních metod? J. Havlasová, Interimun s.r.o. Vlastnosti charakterizující laboratorní metodu: 1. z hlediska analytického přesnost/ správnost ( nejistota měření ) analytická citlivost

Více

Srovnání kanalizačních sítí v Evropě projekt SMP ( SMP - Sustainable Municipal Project )

Srovnání kanalizačních sítí v Evropě projekt SMP ( SMP - Sustainable Municipal Project ) Srovnání kanalizačních sítí v Evropě projekt SMP ( SMP - Sustainable Municipal Project ) Ing. Pavel Prokop, ADPP I. Úvod Historie inženýrských sítí sahá do hluboké minulosti. Bylo potřeba vést či přivádět

Více

Získávání znalostí z databází. Alois Kužela

Získávání znalostí z databází. Alois Kužela Získávání znalostí z databází Alois Kužela Obsah související pojmy datové sklady, získávání znalostí asocianí pravidla 2/37 Úvod získávání znalostí z dat, dolování (z) dat, data mining proces netriviálního

Více

Cvičení 11. Přednášející: Mgr. Rudolf B. Blažek, Ph.D. prof. RNDr. Roman Kotecký, DrSc.

Cvičení 11. Přednášející: Mgr. Rudolf B. Blažek, Ph.D. prof. RNDr. Roman Kotecký, DrSc. 11 Přednášející: Mgr. Rudolf B. Blažek, Ph.D. prof. RNDr. Roman Kotecký, DrSc. Katedra počítačových systémů Katedra teoretické informatiky Fakulta informačních technologií České vysoké učení technické

Více

Jak psát Bc. resp. Mgr. závěrečnou práci. Zpracoval: Karel Bílek

Jak psát Bc. resp. Mgr. závěrečnou práci. Zpracoval: Karel Bílek Jak psát Bc. resp. Mgr. závěrečnou práci Zpracoval: Karel Bílek Tato prezentace vznikla v rámci řešení doktorského projektu GAČR 523/03/H076 duben 2005 Textový dokument... co to je? Textovým dokumentem

Více

Variabilita heterochromatinové oblasti lidského chromosomu 9 z evolučního a klinického hlediska

Variabilita heterochromatinové oblasti lidského chromosomu 9 z evolučního a klinického hlediska Variabilita heterochromatinové oblasti lidského chromosomu 9 z evolučního a klinického hlediska A. Šípek jr. (1), R. Mihalová (1), A. Panczak (1), L. Hrčková (1), P. Lonský (2), M. Janashia (1), M. Kohoutová

Více

VYUŽITÍ MATLAB WEB SERVERU PRO INTERNETOVOU VÝUKU ANALÝZY DAT A ŘÍZENÍ JAKOSTI

VYUŽITÍ MATLAB WEB SERVERU PRO INTERNETOVOU VÝUKU ANALÝZY DAT A ŘÍZENÍ JAKOSTI VYUŽITÍ MATLAB WEB SERVERU PRO INTERNETOVOU VÝUKU ANALÝZY DAT A ŘÍZENÍ JAKOSTI Aleš Linka 1, Petr Volf 2 1 Katedra textilních materiálů, FT TUL, 2 Katedra aplikované matematiky, FP TUL ABSTRAKT. Internetové

Více

FUNKCE 2. Autor: Mgr. Dana Kaprálová. Datum (období) tvorby: září, říjen 2013. Ročník: sedmý. Vzdělávací oblast: Informatika a výpočetní technika

FUNKCE 2. Autor: Mgr. Dana Kaprálová. Datum (období) tvorby: září, říjen 2013. Ročník: sedmý. Vzdělávací oblast: Informatika a výpočetní technika FUNKCE 2 Autor: Mgr. Dana Kaprálová Datum (období) tvorby: září, říjen 2013 Ročník: sedmý Vzdělávací oblast: Informatika a výpočetní technika 1 Anotace: Žáci se seznámí se základní obsluhou tabulkového

Více

Biometrie Finger Vein Nová generace bezpečnosti v bankovnictví

Biometrie Finger Vein Nová generace bezpečnosti v bankovnictví Biometrie Finger Vein Nová generace bezpečnosti v bankovnictví cardforum Seč 27/5/2014 Stanislav Novák Business Development Manager Banking Sales Biometrie Finger Vein Strategické partnerství s firmou

Více

Algoritmy I, složitost

Algoritmy I, složitost A0B36PRI - PROGRAMOVÁNÍ Algoritmy I, složitost České vysoké učení technické Fakulta elektrotechnická v 1.01 Rychlost... Jeden algoritmus (program, postup, metoda ) je rychlejší než druhý. Co ta věta znamená??

Více

K metodám převodu souřadnic mezi ETRS 89 a S-JTSK na území ČR

K metodám převodu souřadnic mezi ETRS 89 a S-JTSK na území ČR K metodám převodu souřadnic mezi ETRS 89 a S-JTSK na území ČR Vlastimil Kratochvíl * Příspěvek obsahuje popis vlastností některých postupů, využitelných pro transformaci souřadnic mezi geodetickými systémy

Více

Statistika. Semestrální projekt

Statistika. Semestrální projekt Statistika Semestrální projekt 18.5.2013 Tomáš Jędrzejek, JED0008 Obsah Úvod 3 Analyzovaná data 4 Analýza dat 6 Statistická indukce 12 Závěr 15 1. Úvod Cílem této semestrální práce je aplikovat získané

Více

CSS. SEO Search Engine Optimization (optimalizace pro vyhledávače)

CSS. SEO Search Engine Optimization (optimalizace pro vyhledávače) CSS SEO Search Engine Optimization (optimalizace pro vyhledávače) Autorem materiálu a všech jeho částí, není-li uvedeno jinak, je Mgr. Marek Čechák. Financováno z ESF a státního rozpočtu ČR. Název školy

Více

3. Je defenzivní programování technikou skrývání implementace? Vyberte jednu z nabízených možností: Pravda Nepravda

3. Je defenzivní programování technikou skrývání implementace? Vyberte jednu z nabízených možností: Pravda Nepravda 1. Lze vždy z tzv. instanční třídy vytvořit objekt? 2. Co je nejčastější příčinou vzniku chyb? A. Specifikace B. Testování C. Návrh D. Analýza E. Kódování 3. Je defenzivní programování technikou skrývání

Více

Nejistota měř. ěření, návaznost a kontrola kvality. Miroslav Janošík

Nejistota měř. ěření, návaznost a kontrola kvality. Miroslav Janošík Nejistota měř ěření, návaznost a kontrola kvality Miroslav Janošík Obsah Referenční materiály Návaznost referenčních materiálů Nejistota Kontrola kvality Westgardova pravidla Unity Referenční materiál

Více

OBOROVÁ RADA BIOCHEMIE A PATOBIOCHEMIE

OBOROVÁ RADA BIOCHEMIE A PATOBIOCHEMIE OBOROVÁ RADA BIOCHEMIE A PATOBIOCHEMIE Předseda: Stanislav Štípek, prof., MUDr., DrSc. Ústav lékařske biochemie a laboratorní disgnostiky 1. LF UK Kateřinská 32, 121 08 Praha 2 tel.: 224 964 283 fax: 224

Více

Molekulární diagnostika

Molekulární diagnostika Molekulární diagnostika Odry 11. 11. 2010 Michal Pohludka, Ph.D. Buňka základní jednotka živé hmoty Všechny v současnosti známé buňky se vyvinuly ze společného předka, tedy buňky, která žila asi před 3,5-3,8

Více

Customer Intelligence, aneb Jak může neoblíbená analýza dat usnadnit práci marketingu

Customer Intelligence, aneb Jak může neoblíbená analýza dat usnadnit práci marketingu Customer Intelligence, aneb Jak může neoblíbená analýza dat usnadnit práci marketingu Filip Trojan Applied Analytics Manager, Deloitte Advisory Listopad 2012 Obsah 1. Představení 2. Marketing versus analýza

Více

Prameny odborné literatury - zdroje

Prameny odborné literatury - zdroje - zdroje 1) Kde hledat odbornou literaturu knihovny, internet 2) Kde vyhledávat časopisy a články na internetu Kde hledat odbornou literaturu Kde je hledat Zdroje: klasické knihovny katalogy elektronické

Více

Počet chromosomů v buňkách. Genom

Počet chromosomů v buňkách. Genom Počet chromosomů v buňkách V každé buňce těla je stejný počet chromosomů. Výjimkou jsou buňky pohlavní, v nich je počet chromosomů poloviční. Spojením pohlavních buněk vzniká zárodečná buňka s celistvým

Více

ANALÝZA A OPTIMALIZACE VÝROBNÍCH PROCESŮ MALOSÉRIOVÉ SLOŽITÉ VÝROBY V NOVÝCH VÝROBNÍCH PROSTORECH NA ZÁKLADĚ DISKRÉTNÍ SIMULACE

ANALÝZA A OPTIMALIZACE VÝROBNÍCH PROCESŮ MALOSÉRIOVÉ SLOŽITÉ VÝROBY V NOVÝCH VÝROBNÍCH PROSTORECH NA ZÁKLADĚ DISKRÉTNÍ SIMULACE ANALÝZA A OPTIMALIZACE VÝROBNÍCH PROCESŮ MALOSÉRIOVÉ SLOŽITÉ VÝROBY V NOVÝCH VÝROBNÍCH PROSTORECH NA ZÁKLADĚ DISKRÉTNÍ SIMULACE Doc. Václav Votava, CSc. (a), Ing. Zdeněk Ulrych, Ph.D. (b), Ing. Milan Edl,

Více

Simulace. Simulace dat. Parametry

Simulace. Simulace dat. Parametry Simulace Simulace dat Menu: QCExpert Simulace Simulace dat Tento modul je určen pro generování pseudonáhodných dat s danými statistickými vlastnostmi. Nabízí čtyři typy rozdělení: normální, logaritmicko-normální,

Více

ZÍSKÁVÁNÍ ZNALOSTÍ Z DATABÁZÍ

ZÍSKÁVÁNÍ ZNALOSTÍ Z DATABÁZÍ metodický list č. 1 Dobývání znalostí z databází Cílem tohoto tematického celku je vysvětlení základních pojmů z oblasti dobývání znalostí z databází i východisek dobývání znalostí z databází inspirovaných

Více