Thursday, February 27, 14

Rozměr: px
Začít zobrazení ze stránky:

Download "Thursday, February 27, 14"

Transkript

1

2 DATABÁZE A VYHLEDÁVÁNÍ SEKVENCÍ MOLEKULÁRNÍ TAXONOMIE 2014 MARIAN NOVOTNÝ

3 PŘEDNÁŠEJÍCÍ Mgr. Marian NOVOTNÝ, PhD. vystudoval odbornou biologii na PřF UK, diplomka v laboratoři doc. Folka doktorát na Uppsalské univerzitě se specializací strukturní bioinformatika (Gerard Kleywegt) Marie Curie Fellow na Evropském Bioinformatickém Institutu (Janet Thornton & Roman Laskowski) ornitolog amatér

4 OSNOVA co je substrát pro molekulární taxonomii? kde se shromažďují data? jak data vyhledávat?

5 REKONSTRUKCE EVOLUČNÍ HISTORIE rekonstrukce na základě srovnávání znaků v molekulární taxonomii se používají sekvence sekvence (DNA, RNA, proteiny) se srovnávají tzv. alignmentem

6 KDE NAJÍT SEKVENCE?

7 BIOINFORMATICKÉ DATABÁZE úložiště dat (volně) dostupné pro kohokoliv snadno k nalezení lednové číslo Nucleid Acid Research (NAR)

8 LEDNOVÉ ČÍSLO NAR NUCLEOTIDE SEQUENCE DATABASES RNA SEQUENCE DATABASES PROTEIN SEQUENCE DATABASES STRUCTURE DATABASES GENOMICS DATABASES (NON-VERTEBRATE) METABOLIC AND SIGNALING PATHWAYS HUMAN AND OTHER VERTEBRATE GENOMES HUMAN GENES AND DISEASES MICROARRAY DATA AND OTHER GENE EXPRESSION DATABASES PROTEOMICS RESOURCES OTHER MOLECULAR BIOLOGY DATABASES ORGANELLE DATABASES PLANT DATABASES IMMUNOLOGICAL DATABASES

9 VLASTNOSTI DATABÁZE četnost aktualizace dat četnost aktualizace software redundance anotace dat anotace databáze

10

11

12

13

14 ...A NÁSTROJE

15 DNA DATABÁZE GenBank(NCBI) EMBL (EBI) DDJB (Japonsko)

16 MÁLO ANOTOVANÁ SEKVENCE

17 ANOTOVANÁ SEKVENCE

18

19 GENOMOVÉ DATABÁZE

20

21

22

23 PROTEINOVÉ DATABÁZE Uniprot - Swissprot + TrEMBL - 52,7 mil. sek. Swiss-prot - anotováno, ~ sekvencí GenPept - překládaný GenBank

24 UNIPROT + TREMBL AMINO ACID COMPOSITION 2.1 COMPOSITION IN PERCENT FOR THE COMPLETE DATABASE ALA (A) 8.57 GLN (Q) 3.88 LEU (L) 9.81 SER (S) 6.72 ARG (R) 5.47 GLU (E) 6.14 LYS (K) 5.30 THR (T) 5.61 ASN (N) 4.17 GLY (G) 7.08 MET (M) 2.45 TRP (W) 1.31 ASP (D) 5.28 HIS (H) 2.20 PHE (F) 4.03 TYR (Y) 3.06 CYS (C) 1.29 ILE (I) 6.00 PRO (P) 4.74 VAL (V) 6.71 ASX (B) GLX (Z) XAA (X) 0.06

25

26

27 JAK DATA VYHLEDÁVAT?

28 >ASTAKINE MKMRGVSVGVLVVAMMSGLAMAGSCNSQEPDCGPSECCLQGWMR YSTRGCAPLGEAGSSCNVFTQAPVKGFYIGMCPCRAGLVCTRPSATCQLPSQDNTLDSYY EXISTUJÍ PŘÍBUZNÉ SEKVENCE A KDE JE NAJÍT?

29 HLEDÁNÍ V DATABÁZÍCH - ALGORITMY tradiční algoritmy (Needleman-Wunsch, Smith-Waterman) pomalé pro prohledávání velkých databází používány heuristické metody - rychle vede k výsledku, který se blíží optimálnímu řešení (ale nezaručuje jej) -> pro vyšší rychlost je obětována přesnost (rule of thumb) v případě sekvenčního srovnávání se metoda vzdává jistoty nalezení optimálního alignmentu, aby v krátkém čase provedla srovnání se všemi sekvencemi v databázi (50-100x rychlejší) klasickými heuristickými metodami jsou FASTA a BLAST obě metody použitelné pro DNA i proteinové sekvence

30 FASTA metoda popsaná v 80. letech 20. století (Lipman & Pearson) rychlá, heuristická metoda (na úkor senzitivity), globální alignment zjednodušení v první fázi, sekvence rozděleny na krátké úseky program generuje všechny možné k-tuples o délce k z dané sekvence k = 1-2 pro proteiny, k = 4-6 pro DNA k-tuples jsou porovnávány s k-tuples sekvencí v databázích

31 FASTA hledání SHOD v k-tuples skórováni shod pomocí skórovací tabulky (Blosum 50) a rozšíření alignmentu (bez mezer) vysoce skórující shody vybrány vybere úseky, které budou součástí alignmentu dynamické programování pro konečný alignment (mezery)

32 BLAST BLAST = Basic Local Alignment Search Tool Altschul et al., 1990 sekvence rozděleny na slova (words) a slova skórována vůči databázi všech slov slova skórována skórovací tabulkou (Blosum 62) a jen ty, které dosáhnou předem nadefinovaného minimálního skóre (treshold) jsou dále používány slova se skóre větším než treshold nemusí nutně obsahovat jen shody ( na rozdíl od Fasty) v prvním kroku se porovnávají slova bez mezer

33 BLAST - HSP HSP - high scoring pair vyber jen taková slova, která dosahují alespoň skóre X (treshold) PEG versus PQA PEQ má s Blosum 62 skóre 15, PQA jen 12 pokud si stanovíme treshold 13, tak budeme dále hledat jen slovo PEQ

34 BLAST II takto vybráná slova jsou hledána v databázi modifikovaným Smith- Watermanem (50 x rychlejší) HSP jsou dále rozšiřovány na obě strany dokud skóre roste v posledním kroku jsou nejlépe skórující páry (HSP`s) podrobeny dynamickému programování, které produkuje výsledné skóre a alignment vzhledem k rostoucí velikosti databází je třeba algoritmus neustále modifikovat (dvě shody v okně definované velikosti) obvykle citlivější než FASTA implementován jako server na řadě míst (NCBI, EBI)

35 VERZE BLASTU blastn - hledá s DNA sekvencí (query) v DNA databázi blastp - hledá s proteinovou sekvencí v proteinové databázi blastx - hledá s DNA sekvencí (6 rámců) v proteinové databázi tblastn - hledá s proteinovou sekvencí v DNA databázi tblastx - překládaná DNA v překládané DNA databázi megablast - víc query najednou

36

37

38 BLAST - VÝBĚR databáze - DNA x protein, anotovaná x kompletní, strukturní, genomové, specializované (protilátky)... organismus datum - sekvence za poslední dva týdny skórovací tabulka - blosum 62 velikost slova low-complexity region filter - často P, D, N, E - false positive default nastavení algoritmu vhodné ve většině případů

39 BLOSUM BLOSUM 80 - tabulka vypočítaná na základě alignmentu bloku sekvencí s identitou 80 % BLOSUM 62 - tabulka vypočítaná na základě alignmentu bloku sekvencí s identitou 62 %

40 BLOSUM VERSUS PAM PAM 10 BLOSUM 90 PAM 250 BLOSUM 62 VELMI PŘÍBUZNÍ VZDÁLENĚ PŘÍBUZNÍ

41 VÝZNAMNOST NÁLEZU optimální alignment lze nalézt pro jakékoliv dvě sekvence dvě náhodné DNA sekvence = ~ 25% SI dvě náhodné proteinové sekvence = ~ 5% SI jak určit, že je alignment statisticky významný?

42 PARAMETRY VÝZNAMNOSTI P-value E-value pouze statistická významnost skóre -> biologickou relevanci záhodno ověřovat experimentálně

43 P-VALUE P-value - pravděpodobnost, že sekvence budou srovnány s nalezeným nebo vyšším skóre a zároveň nebudou příbuzné (false positive hit) P-value - pravděpodobnost, že bude skóre x nebo vyššího dosaženo náhodou pro účely výpočtu lze náhodu simulovat přeskládáváním sekvencí nebo výběrem vzorku z databáze druhá možnost lépe odpovídá realitě a poskytuje lepší výsledky (především u DNA)

44 EVD rozložení skóre lokálních alignmentů nepříbuzných sekvencí neodpovídá normálnímu rozdělení, ale rozdělení podle extrémních hodnot (EVD) při normálním rozdělení by docházelo k přeceňování významu dosažených skóre DUNDAS ET AL. BMC BIOINFORMATICS 2007

45 P-VALUE P-value (S>x) = 1-exp (-exp (-λ(x-u))), u = charakteristická hodnota = Kmn/λ m,n = délky sekvencí; K = konstanta; λ = decay factor K a λ mohou být kalkulovány z vlastností skórovací tabulky

46 E-VALUE E-value = pravděpodobnost, že bude dosaženo skóre x nebo vyššího náhodou v databázi dané velikosti E-value = P-value x N ; velikost databáze příklad: databáze o miliónu sekvencí a P-value = 10-6 cutoff (expect treshold) parametr v BLASTU - udává kolik lze průměrně očekávat false positives v databázi dané velikosti -> způsob jak vyvažovat senzitivitu a selektivitu nižší hodnota cutoff zvyšuje selektivitu, ale snižuje senzitivitu

47 E-VALUE E-value = pravděpodobnost, že bude dosaženo skóre x nebo vyššího náhodou v databázi dané velikosti E-value = P-value x N ; velikost databáze příklad: databáze o miliónu sekvencí a P-value = 10-6 E-value = 10-6 x 10 6 =1 cutoff (expect treshold) parametr v BLASTU - udává kolik lze průměrně očekávat false positives v databázi dané velikosti -> způsob jak vyvažovat senzitivitu a selektivitu nižší hodnota cutoff zvyšuje selektivitu, ale snižuje senzitivitu

48 BLAST / EVOLUČNÍ VZDÁLENOST říká nám BLAST něco o příbuznosti nalezených sekvencí? Je první hit evolučně nejpříbuznější query (hledané sekvenci)?

49 BLAST / EVOLUČNÍ VZDÁLENOST říká nám BLAST něco o příbuznosti nalezených sekvencí? Je první hit evolučně nejpříbuznější query (hledané sekvenci)? BLAST většinou nalezá příbuzné sekvence nejpříbuznější sekvence však mohou chybět v databázi lokální alignment - často skóruje nejlépe vzdálené příbuzné 7 % sekvencí E.coli mělo nejlépe skórující sekvenci mimo Bacteria

50

51

52 2JTK

53 SEQUENCE IDENTITA/HOMOLOGIE NEHOMOLOGNÍ PROTEINY ROST, 1999

54 SEQUENCE IDENTITA/HOMOLOGIE HOMOLOGNÍ PROTEINY ROST, 1999

55 SEQUENCE IDENTITA/HOMOLOGIE sekvenční identita > 35% - pravděpodobně homolog sekvenční identita = 20-35% ( twilight zone ; Doolittle) - může být homolog sekvenční identita < 20% - midnight zone (Rost) - sekvence zcela nedostatečná k určení homologie

56 SANDER ET AL., PREPRINT Average sequence identity of random alignments % Average sequence identity of remote homologues %

57 SSEARCH pokud máte moře času nebo počítačový klastr nebo jste zoufalí rigorózní Smith-Waterman - local alignment v databázi

58 DALŠÍ METODY HLEDÁNÍ V DATABÁZÍCH profilové metody HMM modely

59 PROFILY modifikují skórovací tabulky specificky pro skupiny proteinů a pozici v alignmentu (např. globiny) pro každou pozici v alignmentu jsou generovány specifická skóre jak pro záměnu za jakoukoliv aa, tak pro inzerci nebo deleci Prof (pos,aa) = Σtype N(pos,type) x S(type, aa) x 10 N(pos,type) = podíl výskytu aa x na pozici y S(type, aa) = skóre skórovací tabulky pro zaměňovaný pár

60 PŘÍKLAD PROFILU v alignmentu globinů se na pozici 3 vyskytuje 3x Ala, 6x Val, 1x Ile, používáme tabulku Blosum 62 jaké bude profilové skóre pro výskyt Ile a His? N(x,A) = 0.3, N(x,V) = 0.6, N(x, I) = 0.1 S(A,I) = -1, S(V,I) = 3, S(I,I) = 4 S(A,H) = -2, S(V,H) = -3, S(I,H) = -3 Prof (x, I) = 0.3 x x x 4 = 2.1 x 10 (v profilu) = 21 ( -1, 3, 4) Prof (x, H) = 0.3 x x x -3 = -2.7 x 10 = -27 (-2, -3, -3)

61 PSI-BLAST PSI-BLAST = Position Specific Iterative Blast Altschul et al., 1997 profilová metoda, používá Position Specific Scoring Matrix (PSSM) v prvním kole klasický BLAST, z vysoko skórujících alignmentů je generována PSSM v dalším kole hledání je už použita nová matrice a následně znovu generována nová PSSM opakováno libovolně dlouho (až ke konvergenci) benchmark metoda

62 HMM HMM = Hidden Markov Model profilová metoda, používána při rozhodování, zda protein spadá do jisté skupiny proteinů, typicky pro sekvence s nízkou %SI velmi citlivá metoda, která vytváří statistický model pro definovanou skupinu sekvencí na základě tréninku na sekvencích patřících do jedné skupiny (globiny) generuje pravděpodobnost nejen pro jednotlivé záměny a inzerce a delece, ale i pro přechody mezi nima dovede do modelu zahrnout i aminokyseliny, které se v tréninkové skupině nevyskytují alignment s největší pravděpodobností je optimální posuzuje jak dobře daná sekvence odpovídá modelu

63 HMM

64 SHRNUTÍ databáze by měly být pravidelně updatovány přehled dostupných biologických databází vždy v lednovém čísle NAR řada velmi specializovaných databází hledání v databázích povětšinou heuristickými metodami standard dnes BLAST nutno hodnotit statistickou významnost nálezu citlivější metodou PSI-Blast nebo HMM metody

Studijní materiály pro bioinformatickou část ViBuChu. úloha II. Jan Komárek, Gabriel Demo

Studijní materiály pro bioinformatickou část ViBuChu. úloha II. Jan Komárek, Gabriel Demo Studijní materiály pro bioinformatickou část ViBuChu úloha II Jan Komárek, Gabriel Demo Adenin Struktura DNA Thymin 5 konec 3 konec DNA tvořena dvěmi řetězci orientovanými antiparalelně (liší se orientací

Více

Evropský sociální fond Praha & EU: Investujeme do vaší budoucnosti URČOVÁNÍ PRIMÁRNÍ STRUKTURY BÍLKOVIN

Evropský sociální fond Praha & EU: Investujeme do vaší budoucnosti URČOVÁNÍ PRIMÁRNÍ STRUKTURY BÍLKOVIN Evropský sociální fond Praha & EU: Investujeme do vaší budoucnosti URČOVÁNÍ PRIMÁRNÍ STRUKTURY BÍLKOVIN Primární struktura primární struktura bílkoviny je dána pořadím AK jejích polypeptidových řetězců

Více

Inovace studia molekulární a buněčné biologie

Inovace studia molekulární a buněčné biologie Inovace studia molekulární a buněčné biologie Tento projekt je spolufinancován Evropským sociálním fondem a státním rozpočtem České republiky. MBIO1/Molekulární biologie 1 Tento projekt je spolufinancován

Více

Bioinformatika a funkční studie

Bioinformatika a funkční studie Bioinformatika a funkční studie Bioinformatika Vztah informace a funkce Sekvenování DNA Proteinů Databáze Primární Sekundární Integrované internetové zdroje informací Vyhledávání sekvenční podobnosti,

Více

Genomické databáze. Shlukování proteinových sekvencí. Ivana Rudolfová. školitel: doc. Ing. Jaroslav Zendulka, CSc.

Genomické databáze. Shlukování proteinových sekvencí. Ivana Rudolfová. školitel: doc. Ing. Jaroslav Zendulka, CSc. Genomické databáze Shlukování proteinových sekvencí Ivana Rudolfová školitel: doc. Ing. Jaroslav Zendulka, CSc. Obsah Proteiny Zdroje dat Predikce struktury proteinů Cíle disertační práce Vstupní data

Více

Proteiny Genová exprese. 2013 Doc. MVDr. Eva Bártová, Ph.D.

Proteiny Genová exprese. 2013 Doc. MVDr. Eva Bártová, Ph.D. Proteiny Genová exprese 2013 Doc. MVDr. Eva Bártová, Ph.D. Bílkoviny (proteiny), 15% 1g = 17 kj Monomer = aminokyseliny aminová skupina karboxylová skupina α -uhlík postranní řetězec Znát obecný vzorec

Více

Bioinformatika a výpočetní biologie KFC/BIN. I. Přehled

Bioinformatika a výpočetní biologie KFC/BIN. I. Přehled Bioinformatika a výpočetní biologie KFC/BIN I. Přehled RNDr. Karel Berka, Ph.D. Univerzita Palackého v Olomouci Definice bioinformatiky (Molecular) bio informatics: bioinformatics is conceptualising biology

Více

Osekvenované genomy. Pan troglodydes, 2005. Neandrtálec, 2010

Osekvenované genomy. Pan troglodydes, 2005. Neandrtálec, 2010 GENOMOVÉ PROJEKTY Osekvenované genomy Haemophilus influenze, 1995 první osekvenovaná bakterie Saccharomyces cerevisiae, 1996 první osekvenovaný eukaryotický organimus Caenorhabditis elegans, 1998 první

Více

Využití strojového učení k identifikaci protein-ligand aktivních míst

Využití strojového učení k identifikaci protein-ligand aktivních míst Využití strojového učení k identifikaci protein-ligand aktivních míst David Hoksza, Radoslav Krivák SIRET Research Group Katedra softwarového inženýrství, Matematicko-fyzikální fakulta Karlova Univerzita

Více

Co se o sobě dovídáme z naší genetické informace

Co se o sobě dovídáme z naší genetické informace Genomika a bioinformatika Co se o sobě dovídáme z naší genetické informace Jan Pačes, Mgr, Ph.D Ústav molekulární genetiky AVČR, CZECH FOBIA (Free and Open Bioinformatics Association) hpaces@img.cas.cz

Více

Aminokyseliny příručka pro učitele. Obecné informace: Téma otevírá kapitolu Bílkoviny, která svým rozsahem překračuje rámec jedné vyučovací hodiny.

Aminokyseliny příručka pro učitele. Obecné informace: Téma otevírá kapitolu Bílkoviny, která svým rozsahem překračuje rámec jedné vyučovací hodiny. Obecné informace: Aminokyseliny příručka pro učitele Téma otevírá kapitolu Bílkoviny, která svým rozsahem překračuje rámec jedné vyučovací hodiny. Navazující učivo Před probráním tématu Aminokyseliny probereme

Více

Metabolismus bílkovin. Václav Pelouch

Metabolismus bílkovin. Václav Pelouch ZÁKLADY OBECNÉ A KLINICKÉ BIOCHEMIE 2004 Metabolismus bílkovin Václav Pelouch kapitola ve skriptech - 3.2 Výživa Vyvážená strava člověka musí obsahovat: cukry (50 55 %) tuky (30 %) bílkoviny (15 20 %)

Více

Metabolismus aminokyselin. Vladimíra Kvasnicová

Metabolismus aminokyselin. Vladimíra Kvasnicová Metabolismus aminokyselin Vladimíra Kvasnicová Aminokyseliny aminokyseliny přijímáme v potravě ve formě proteinů: důležitá forma organicky vázaného dusíku, který tak může být v těle využit k syntéze dalších

Více

Bioinformatika pro PrfUK 2003

Bioinformatika pro PrfUK 2003 Bioinformatika pro PrfUK 2003 Jiří Vondrášek Ústav organické chemie a biochemie vondrasek@uochb.cas.cz Jan Pačes Ústav molekulární genetiky hpaces@img.cas.cz http://bio.img.cas.cz/prfuk2003 What is Bioinformatics?---The

Více

Biologie. Autorské řešení kvalifikační úlohy

Biologie. Autorské řešení kvalifikační úlohy Biologie Autorské řešení kvalifikační úlohy Přepis sekvence ze sekvenátoru A C G T 5' C G T T C T A T A G A T A C G C G A T G A C G G T A T A C C A T C C G C A A A G T 3' http://blast.ncbi.nlm.nih.gov/

Více

Počítačová analýza lokálních podobností mezi biologickými sekvencemi

Počítačová analýza lokálních podobností mezi biologickými sekvencemi MASARYKOVA UNIVERZITA V BRNĚ Fakulta informatiky Michal VAVERKA Počítačová analýza lokálních podobností mezi biologickými sekvencemi Bakalářská práce Vedoucí práce: Ing. Matej Lexa, Ph.D. Brno 2006 Prohlašuji,

Více

PREDIKTOR VLIVU AMINOKYSELINOVÝCH SUBSTITUCÍ NA FUNKCI PROTEINŮ

PREDIKTOR VLIVU AMINOKYSELINOVÝCH SUBSTITUCÍ NA FUNKCI PROTEINŮ VYSOKÉ UČENÍ TECHNICKÉ V BRNĚ BRNO UNIVERSITY OF TECHNOLOGY FAKULTA INFORMAČNÍCH TECHNOLOGIÍ ÚSTAV INFORMAČNÍCH SYSTÉMŮ FACULTY OF INFORMATION TECHNOLOGY DEPARTMENT OF INFORMATION SYSTEMS PREDIKTOR VLIVU

Více

Bioinformatika. hledání významu biologických dat. Marian Novotný. Friday, April 24, 15

Bioinformatika. hledání významu biologických dat. Marian Novotný. Friday, April 24, 15 Bioinformatika hledání významu biologických dat Marian Novotný Bioinformatika sběr biologických dat archivace biologických dat organizace biologických dat interpretace biologických dat 2 Biologové sbírají

Více

Struktury a vazebné energie iontových klastrů helia

Struktury a vazebné energie iontových klastrů helia Společný seminář 11. června 2012 Struktury a vazebné energie iontových klastrů helia Autor: Lukáš Červenka Vedoucí práce: Doc. RNDr. René Kalus, Ph.D. Technický úvod Existují ověřené optimalizační algoritmy

Více

Pravděpodobnost v závislosti na proměnné x je zde modelován pomocí logistického modelu. exp x. x x x. log 1

Pravděpodobnost v závislosti na proměnné x je zde modelován pomocí logistického modelu. exp x. x x x. log 1 Logistická regrese Menu: QCExpert Regrese Logistická Modul Logistická regrese umožňuje analýzu dat, kdy odezva je binární, nebo frekvenční veličina vyjádřená hodnotami 0 nebo 1, případně poměry v intervalu

Více

Bioinformatika. Alignment 2. http://bio.img.cas.cz. Jiří Vondrášek Ústav organické chemie a biochemie vondrasek@uochb.cas.cz

Bioinformatika. Alignment 2. http://bio.img.cas.cz. Jiří Vondrášek Ústav organické chemie a biochemie vondrasek@uochb.cas.cz Bioinformatika lignment http://bio.img.cas.cz Jiří Vondrášek Ústav organické chemie a biochemie vondrasek@uochb.cas.cz Jan Pačes Ústav molekulární genetiky hpaces@img.cas.cz typy alignmentů : :n n:n n

Více

Metabolismus aminokyselin 2. Vladimíra Kvasnicová

Metabolismus aminokyselin 2. Vladimíra Kvasnicová Metabolismus aminokyselin 2 Vladimíra Kvasnicová Odbourávání AMK 1) odstranění aminodusíku z molekuly AMK 2) detoxikace uvolněné aminoskupiny 3) metabolismus uhlíkaté kostry AMK 7 produktů 7 degradačních

Více

Vyhledávání příbuzných enzymů s modifikovanou funkcí v proteinových databázích

Vyhledávání příbuzných enzymů s modifikovanou funkcí v proteinových databázích 2015 http://excel.fit.vutbr.cz Vyhledávání příbuzných enzymů s modifikovanou funkcí v proteinových databázích Jiří Hon* Abstrakt Hledání příbuzných enzymů v biologických databázích patří mezi obvyklé činnosti

Více

6. Kde v DNA nalézáme rozdíly, zodpovědné za obrovskou diverzitu života?

6. Kde v DNA nalézáme rozdíly, zodpovědné za obrovskou diverzitu života? 6. Kde v DNA nalézáme rozdíly, zodpovědné za obrovskou diverzitu života? Pamatujete na to, co se objevilo v pracích Charlese Darwina a Alfreda Wallace ohledně vývoje druhů? Aby mohl mechanismus přírodního

Více

Statistické metody v ekonomii. Ing. Michael Rost, Ph.D.

Statistické metody v ekonomii. Ing. Michael Rost, Ph.D. Statistické metody v ekonomii Ing. Michael Rost, Ph.D. Jihočeská univerzita v Českých Budějovicích Test χ 2 v kontingenční tabulce typu 2 2 Jde vlastně o speciální případ χ 2 testu pro čtyřpolní tabulku.

Více

E-infrastruktura CESNET - partner výzkumné infrastruktury pro biologická data ELIXIR CZ

E-infrastruktura CESNET - partner výzkumné infrastruktury pro biologická data ELIXIR CZ E-infrastruktura CESNET - partner výzkumné infrastruktury pro biologická data ELIXIR CZ Life Science - od molekul k systému Slovník komponent Gramatika (interakce) Souvislosti a sítě (diagramy ) Atlas

Více

Doprovodný materiál k práci s přípravným textem Biologické olympiády 2014/2015 pro soutěžící a organizátory kategorie B

Doprovodný materiál k práci s přípravným textem Biologické olympiády 2014/2015 pro soutěžící a organizátory kategorie B Doprovodný materiál k práci s přípravným textem Biologické olympiády 2014/2015 pro soutěžící a organizátory kategorie B Níže uvedené komentáře by měly pomoci soutěžícím z kategorie B ke snazší orientaci

Více

Inovace studia molekulární a buněčné biologie

Inovace studia molekulární a buněčné biologie Inovace studia molekulární a buněčné biologie Tento projekt je spolufinancován Evropským sociálním fondem a státním rozpočtem České republiky. MBIO1/Molekulární biologie 1 Tento projekt je spolufinancován

Více

Výuka genetiky na Přírodovědecké fakultě UK v Praze

Výuka genetiky na Přírodovědecké fakultě UK v Praze Výuka genetiky na Přírodovědecké fakultě UK v Praze Studium biologie na PřF UK v Praze Bakalářské studijní programy / obory Biologie Biologie ( duhový bakalář ) Ekologická a evoluční biologie ( zelený

Více

V. letní škola metod molekulární biologie nukleových kyselin a genomiky 16. - 20. 6. 2014. Ústav morfologie, fyziologie a genetiky zvířat AF MENDELU

V. letní škola metod molekulární biologie nukleových kyselin a genomiky 16. - 20. 6. 2014. Ústav morfologie, fyziologie a genetiky zvířat AF MENDELU V. letní škola metod molekulární biologie nukleových kyselin a genomiky 16. - 20. 6. 2014 Ústav morfologie, fyziologie a genetiky zvířat AF MENDELU Zemědělská 1, Budova A, 4. patro (učebny dle programu)

Více

Populační genetika. ) a. Populační genetika. Castle-Hardy-Weinbergova zákonitost. Platí v panmiktické populaci za předpokladu omezujících podmínek

Populační genetika. ) a. Populační genetika. Castle-Hardy-Weinbergova zákonitost. Platí v panmiktické populaci za předpokladu omezujících podmínek Poulační genetika Poulační genetika ORGANISMUS Součást výše organizované soustavy oulace POPULACE Soubor jedinců jednoho druhu Genotyově heterogenní V určitém čase má řirozeně vymezený rostor Velký očet

Více

Využití metagenomiky při hodnocení sanace chlorovaných ethylenů in situ Výsledky pilotních testů

Využití metagenomiky při hodnocení sanace chlorovaných ethylenů in situ Výsledky pilotních testů Využití metagenomiky při hodnocení sanace chlorovaných ethylenů in situ Výsledky pilotních testů Stavělová M.,* Macháčková J.*, Rídl J.,** Pačes J.** * Earth Tech CZ, s.r.o ** ÚMG AV ČR PROČ METAGENOMIKA?

Více

Vyhledávání nebo nalezení informací

Vyhledávání nebo nalezení informací Vyhledávání nebo nalezení informací Vilém Sklenák sklenak@vse.cz Vysoká škola ekonomická, fakulta informatiky a statistiky, katedra informačního a znalostního inženýrství Inforum2012, 23. 5. 2012 Vilém

Více

ČVUT FEL X36PAA - Problémy a algoritmy. 4. úloha - Experimentální hodnocení algoritmů pro řešení problému batohu

ČVUT FEL X36PAA - Problémy a algoritmy. 4. úloha - Experimentální hodnocení algoritmů pro řešení problému batohu ČVUT FEL X36PAA - Problémy a algoritmy 4. úloha - Experimentální hodnocení algoritmů pro řešení problému batohu Jméno: Marek Handl Datum: 3. 2. 29 Cvičení: Pondělí 9: Zadání Prozkoumejte citlivost metod

Více

Ekonomické aspekty statistické regulace pro vysoce způsobilé procesy. Kateřina Brodecká

Ekonomické aspekty statistické regulace pro vysoce způsobilé procesy. Kateřina Brodecká Ekonomické aspekty statistické regulace pro vysoce způsobilé procesy Kateřina Brodecká Vysoce způsobilé procesy s rozvojem technologií a důrazem kladeným na aktivity neustálého zlepšování a zeštíhlování

Více

Biotechnologický kurz. II. letní škola metod molekulární biologie nukleových kyselin a genomiky 17. - 21. 6. 2013

Biotechnologický kurz. II. letní škola metod molekulární biologie nukleových kyselin a genomiky 17. - 21. 6. 2013 Biotechnologický kurz Biotechnologický kurz II. letní škola metod molekulární biologie nukleových kyselin a genomiky 17. - 21. 6. 2013 Ústav morfologie, fyziologie a genetiky zvířat AF MENDELU v Brně Zemědělská

Více

PRODUKTY. Tovek Tools

PRODUKTY. Tovek Tools jsou desktopovou aplikací určenou k vyhledávání informací, tvorbě různých typů analýz a vytváření přehledů a rešerší. Jsou vhodné pro práci i s velkým objemem textových dat z různorodých informačních zdrojů.

Více

CFD výpočtový model bazénu pro skladování použitého paliva na JE Temelín a jeho validace

CFD výpočtový model bazénu pro skladování použitého paliva na JE Temelín a jeho validace CFD výpočtový model bazénu pro skladování použitého paliva na JE Temelín a jeho validace Ondřej Burian Pavel Zácha Václav Železný ČVUT v Praze, Fakulta strojní, Ústav energetiky NUSIM 2013 Co je to CFD?

Více

MATEMATICKÁ BIOLOGIE

MATEMATICKÁ BIOLOGIE INSTITUT BIOSTATISTIKY A ANALÝZ Lékařská a Přírodovědecká fakulta, Masarykova univerzita MATEMATICKÁ BIOLOGIE Přírodovědecká fakulta Masarykova univerzita, Brno Studijní obor Matematická biologie Masarykova

Více

Gibbsovo samplování a jeho využití

Gibbsovo samplování a jeho využití Gibbsovo samplování a jeho využití Regulace genů Hlavní pozornost výzkumů DNA je většinou věnována analýze genů Geny tvoří pouhá 3% lidské DNA Ukazuje se, že zbývající junk DNA má také velký význam Obsahuje

Více

Multirobotická kooperativní inspekce

Multirobotická kooperativní inspekce Multirobotická kooperativní inspekce prostředí Diplomová práce Multirobotická kooperativní inspekce prostředí Diplomová práce Intelligent and Mobile Robotics Group Laboratory for Intelligent Decision Making

Více

NMR biomakromolekul RCSB PDB. Progr. NMR

NMR biomakromolekul RCSB PDB. Progr. NMR NMR biomakromolekul Typy biomakromolekul a možnosti studia pomocí NMR proteiny a peptidy rozmanité složení, omezení jen velikostí molekul nukleové kyseliny (RNA, DNA) a oligonukleotidy omezení malou rozmanitostí

Více

Inferenční statistika - úvod. z-skóry normální rozdělení pravděpodobnost rozdělení výběrových průměrů

Inferenční statistika - úvod. z-skóry normální rozdělení pravděpodobnost rozdělení výběrových průměrů Inferenční statistika - úvod z-skóry normální rozdělení pravděpodobnost rozdělení výběrových průměrů Pravděpodobnost postupy induktivní statistiky vycházejí z teorie pravděpodobnosti pravděpodobnost, že

Více

Maturitní otázky z předmětu PROGRAMOVÁNÍ

Maturitní otázky z předmětu PROGRAMOVÁNÍ Wichterlovo gymnázium, Ostrava-Poruba, příspěvková organizace Maturitní otázky z předmětu PROGRAMOVÁNÍ 1. Algoritmus a jeho vlastnosti algoritmus a jeho vlastnosti, formy zápisu algoritmu ověřování správnosti

Více

Inovace bakalářského studijního oboru Aplikovaná chemie http://aplchem.upol.cz

Inovace bakalářského studijního oboru Aplikovaná chemie http://aplchem.upol.cz Inovace bakalářského studijního oboru Aplikovaná chemie http://aplchem.upol.cz Z.1.07/2.2.00/15.0247 Tento projekt je spolufinancován Evropským sociálním fondem a státním rozpočtem České republiky. Funkční

Více

PCR IN DETECTION OF FUNGAL CONTAMINATIONS IN POWDERED PEPPER

PCR IN DETECTION OF FUNGAL CONTAMINATIONS IN POWDERED PEPPER PCR IN DETECTION OF FUNGAL CONTAMINATIONS IN POWDERED PEPPER Trojan V., Hanáček P., Havel L. Department of Plant Biology, Faculty of Agronomy, Mendel University of Agriculture and Forestry in Brno, Zemedelska

Více

Tovek Tools. Tovek Tools jsou standardně dodávány ve dvou variantách: Tovek Tools Search Pack Tovek Tools Analyst Pack. Připojené informační zdroje

Tovek Tools. Tovek Tools jsou standardně dodávány ve dvou variantách: Tovek Tools Search Pack Tovek Tools Analyst Pack. Připojené informační zdroje jsou souborem klientských desktopových aplikací určených k indexování dat, vyhledávání informací, tvorbě různých typů analýz a vytváření přehledů a rešerší. Jsou vhodné pro práci s velkým objemem textových

Více

Molekulární základ dědičnosti

Molekulární základ dědičnosti Molekulární základ dědičnosti Dědičná informace je zakódována v deoxyribonukleové kyselině, která je uložena v jádře buňky v chromozómech. Zlomovým objevem pro další rozvoj molekulární genetiky bylo odhalení

Více

Aminokyseliny, proteiny, enzymy Základy lékařské chemie a biochemie 2014/2015 Ing. Jarmila Krotká Metabolismus základní projev života látková přeměna souhrn veškerých dějů, které probíhají uvnitř organismu

Více

Pravděpodobnost, náhoda, kostky

Pravděpodobnost, náhoda, kostky Pravděpodobnost, náhoda, kostky Radek Pelánek IV122, jaro 2015 Výhled pravděpodobnost náhodná čísla lineární regrese detekce shluků Dnes lehce nesourodá směs úloh souvisejících s pravděpodobností krátké

Více

2. Modelovací jazyk UML 2.1 Struktura UML 2.1.1 Diagram tříd 2.1.1.1 Asociace 2.1.2 OCL. 3. Smalltalk 3.1 Jazyk 3.1.1 Pojmenování

2. Modelovací jazyk UML 2.1 Struktura UML 2.1.1 Diagram tříd 2.1.1.1 Asociace 2.1.2 OCL. 3. Smalltalk 3.1 Jazyk 3.1.1 Pojmenování 1. Teoretické základy modelování na počítačích 1.1 Lambda-kalkul 1.1.1 Formální zápis, beta-redukce, alfa-konverze 1.1.2 Lambda-výraz jako data 1.1.3 Příklad alfa-konverze 1.1.4 Eta-redukce 1.2 Základy

Více

Moderní systémy pro získávání znalostí z informací a dat

Moderní systémy pro získávání znalostí z informací a dat Moderní systémy pro získávání znalostí z informací a dat Jan Žižka IBA Institut biostatistiky a analýz PřF & LF, Masarykova universita Kamenice 126/3, 625 00 Brno Email: zizka@iba.muni.cz Bioinformatika:

Více

Princip a využití protilátkových mikročipů RNDr. Zuzana Zákostelská

Princip a využití protilátkových mikročipů RNDr. Zuzana Zákostelská Princip a využití protilátkových mikročipů RNDr. Zuzana Zákostelská Laboratoř buněčné a molekulární imunologie Odd. Imunologie a gnotobiologie MBÚ AVČR v.v.i, Praha Konference XXXIII. Imunoanalytické dny

Více

Genetická diverzita masného skotu v ČR

Genetická diverzita masného skotu v ČR Genetická diverzita masného skotu v ČR Mgr. Jan Říha Výzkumný ústav pro chov skotu, s.r.o. Ing. Irena Vrtková 26. listopadu 2009 Genetická diverzita skotu pojem diverzity Genom skotu 30 chromozomu, genetická

Více

Automatická detekce anomálií při geofyzikálním průzkumu. Lenka Kosková Třísková NTI TUL Doktorandský seminář, 8. 6. 2011

Automatická detekce anomálií při geofyzikálním průzkumu. Lenka Kosková Třísková NTI TUL Doktorandský seminář, 8. 6. 2011 Automatická detekce anomálií při geofyzikálním průzkumu Lenka Kosková Třísková NTI TUL Doktorandský seminář, 8. 6. 2011 Cíle doktorandské práce Seminář 10. 11. 2010 Najít, implementovat, ověřit a do praxe

Více

Služby ÚVT pro VaV & IT pro CEITEC. David Antoš

Služby ÚVT pro VaV & IT pro CEITEC. David Antoš Služby ÚVT pro VaV & IT pro CEITEC David Antoš Služby ÚVT pro vědce a výzkumníky Trocha historie záznamy přednášek http://www.video.muni.cz/ úložiště dat historikové z FF, dermatopatologický atlas doc.

Více

Centrum aplikované genomiky, Ústav dědičných metabolických poruch, 1.LFUK

Centrum aplikované genomiky, Ústav dědičných metabolických poruch, 1.LFUK ové technologie v analýze D A, R A a proteinů Stanislav Kmoch Centrum aplikované genomiky, Ústav dědičných metabolických poruch, 1.LFUK Motto : "The optimal health results from ensuring that the right

Více

Obecná struktura a-aminokyselin

Obecná struktura a-aminokyselin AMINOKYSELINY Obsah Obecná struktura Názvosloví, třídění a charakterizace Nestandardní aminokyseliny Reaktivita - peptidová vazba Biogenní aminy Funkce aminokyselin Acidobazické vlastnosti Optická aktivita

Více

VÝUKA studentů celkem 3 000 (bakaláři + magistři + doktorandi); 72 profesorů, 120 docentů

VÝUKA studentů celkem 3 000 (bakaláři + magistři + doktorandi); 72 profesorů, 120 docentů založena roku 1920 centrum výuky a výzkumu rozpočet v roce 2013 cca 1,114 miliardy Kč (zhruba 1:1 státní dotace a grantové prostředky) - z toho biologie má asi 1/3 (i v dalších parametrech) VÝUKA studentů

Více

Inovace studia molekulární a buněčné biologie reg. č. CZ.1.07/2.2.00/07.0354

Inovace studia molekulární a buněčné biologie reg. č. CZ.1.07/2.2.00/07.0354 I n v e s t i c e d o r o z v o j e v z d ě l á v á n í Inovace studia molekulární a buněčné biologie reg. č. CZ.1.07/2.2.00/07.0354 Tento projekt je spolufinancován Evropským sociálním fondem a státním

Více

Interakce viru klíšťové encefalitidy s hostitelským organismem a patogeneze infekce

Interakce viru klíšťové encefalitidy s hostitelským organismem a patogeneze infekce Parazitologický ústav, Akademie věd České republiky Laboratoř interakcí vektor-hostitel České Budějovice Interakce viru klíšťové encefalitidy s hostitelským organismem a patogeneze infekce Daniel Růžek,

Více

Standardní algoritmy vyhledávací.

Standardní algoritmy vyhledávací. Standardní algoritmy vyhledávací. Vyhledávací algoritmy v C++ nám umožňují vyhledávat prvky v datových kontejnerech podle různých kritérií. Také se podíváme na vyhledávání metodou půlením intervalu (binární

Více

Počítačová chemie. výpočetně náročné simulace chemických a biomolekulárních systémů. Zora Střelcová

Počítačová chemie. výpočetně náročné simulace chemických a biomolekulárních systémů. Zora Střelcová Počítačová chemie výpočetně náročné simulace chemických a biomolekulárních systémů Zora Střelcová Národní centrum pro výzkum biomolekul, Masarykova univerzita, Kotlářská 2, 611 37 Brno, Česká Republika

Více

Experimentální systém pro WEB IR

Experimentální systém pro WEB IR Experimentální systém pro WEB IR Jiří Vraný Školitel: Doc. RNDr. Pavel Satrapa PhD. Problematika disertační práce velmi stručný úvod WEB IR information retrieval from WWW, vyhledávání na webu Vzhledem

Více

Od sekvencí k chromozómům: výzkum repetitivní DNA rostlin v Laboratoři molekulární cytogenetiky BC AVČR

Od sekvencí k chromozómům: výzkum repetitivní DNA rostlin v Laboratoři molekulární cytogenetiky BC AVČR ENBIK 2014 Od sekvencí k chromozómům: výzkum repetitivní DNA rostlin v Laboratoři molekulární cytogenetiky BC AVČR Jiří Macas Biologické centrum AVČR Ústav molekulární biologie rostlin České Budějovice

Více

Reranking založený na metadatech

Reranking založený na metadatech České vysoké učení technické v Praze Fakulta informačních technologií Katedra softwarového inženýrství Reranking založený na metadatech MI-VMW Projekt IV - 1 Pavel Homolka Ladislav Kubeš 6. 12. 2011 1

Více

Začínáme s Tovek Tools

Začínáme s Tovek Tools NAJÍT POCHOPIT VYUŽÍT Úvodní seznámení s produktem Tovek Tools JAK SI TOVEK TOOLS NAINSTALUJI?... 2 JAK SI PŘIPOJÍM INFORMAČNÍ ZDROJE, VE KTERÝCH CHCI VYHLEDÁVAT?... 2 JAK MOHU VYHLEDÁVAT V INFORMAČNÍCH

Více

CEITEC a jeho IT požadavky. RNDr. Radka Svobodová Vařeková, Ph.D.

CEITEC a jeho IT požadavky. RNDr. Radka Svobodová Vařeková, Ph.D. CEITEC a jeho IT požadavky RNDr. Radka Svobodová Vařeková, Ph.D. Co je CEITEC? CEITEC je projekt výstavby středoevropského vědecko-výzkumného centra excelence v Brně Zaměření projektu: základní i aplikovaný

Více

ÚSTAV FYZIKÁLNÍ BIOLOGIE JIHOČESKÁ UNIVERZITA V ČESKÝCH BUDĚJOVICÍCH

ÚSTAV FYZIKÁLNÍ BIOLOGIE JIHOČESKÁ UNIVERZITA V ČESKÝCH BUDĚJOVICÍCH ÚSTAV FYZIKÁLNÍ BIOLOGIE JIHOČESKÁ UNIVERZITA V ČESKÝCH BUDĚJOVICÍCH ZPRÁVA O UKONČENÍ PROJEKTU Projekt Název projektu: Impact of host ecology on metabolic capacity of Sodalis allied symbiotic bacteria

Více

6. Problém typové anonymity prvků v kolekci Sjednocení typově rozdílných prvků pomocí rozhraní Kolekce pro jeden typ prvků...

6. Problém typové anonymity prvků v kolekci Sjednocení typově rozdílných prvků pomocí rozhraní Kolekce pro jeden typ prvků... Obsah 5 Obsah Úvod 11 Jak tato kniha vznikla... 11 Co můžete od knížky očekávat... 12 Jak jsou organizovány programy... 13 Poděkování... 14 Kde hledat nejnovější informace... 14 Typografické a syntaktické

Více

Degradační produkty proteinových aduktů v moči jako perspektivní biomarkery kumulativní expozice reaktivním chemickým látkám

Degradační produkty proteinových aduktů v moči jako perspektivní biomarkery kumulativní expozice reaktivním chemickým látkám Degradační produkty proteinových aduktů v moči jako perspektivní biomarkery kumulativní expozice reaktivním chemickým látkám J. Mráz, I. Linhart *, I. Hanzlíková, Š. Dušková, L. Dabrowská, H. Chrástecká,

Více

SEXUALITA UŽIVATELŮ MARIHUANY OČIMA PARTNEREK

SEXUALITA UŽIVATELŮ MARIHUANY OČIMA PARTNEREK SEXUALITA UŽIVATELŮ MARIHUANY OČIMA PARTNEREK Mgr. Alexandra HROUZKOVÁ Katedra psychologie FFUK, Praha Prof. PhDr. Petr WEISS, PhD. Sexuologický ústav VFN a 1.LF UK, Praha ÚVODEM Konopné drogy jsou po

Více

Lokální definice (1) plocha-kruhu

Lokální definice (1) plocha-kruhu Lokální definice (1) syntaxe: (local (seznam definic) výraz) definice jsou dostupné pouze uvnitř příkazu local příklad: (local ( (define Pi 3.1415926) (define (plocha-kruhu r) (* Pi r r)) ) (plocha-kruhu

Více

Výukový materiál zpracován v rámci projektu EU peníze školám Registrační číslo projektu: CZ.1.07/1.5.00/34.0996

Výukový materiál zpracován v rámci projektu EU peníze školám Registrační číslo projektu: CZ.1.07/1.5.00/34.0996 Výukový materiál zpracován v rámci projektu EU peníze školám Registrační číslo projektu: CZ.1.07/1.5.00/34.0996 Šablona: III/2 č. materiálu: VY_32_INOVACE_CHE_413 Jméno autora: Mgr. Alena Krejčíková Třída/ročník:

Více

Střední odborná škola stavební Karlovy Vary Sabinovo náměstí 16, 360 09 Karlovy Vary Autor: Ing. Hana Šmídová Název materiálu:

Střední odborná škola stavební Karlovy Vary Sabinovo náměstí 16, 360 09 Karlovy Vary Autor: Ing. Hana Šmídová Název materiálu: Název školy: Střední odborná škola stavební Karlovy Vary Sabinovo náměstí 16, 360 09 Karlovy Vary Autor: Ing. Hana Šmídová Název materiálu: VY_32_INOVACE_01_ACCESS_P2 Číslo projektu: CZ 1.07/1.5.00/34.1077

Více

Uživatelská podpora v prostředí WWW

Uživatelská podpora v prostředí WWW Uživatelská podpora v prostředí WWW Jiří Jelínek Katedra managementu informací Fakulta managementu Jindřichův Hradec Vysoká škola ekonomická Praha Úvod WWW obsáhlost obsahová i formátová pestrost dokumenty,

Více

CLP ANALYSIS OF MOLECULAR MARKERS DIGITAL IMAGE ANALYSIS OF ELECTROPHOEROGRAMS CZECH VERSION

CLP ANALYSIS OF MOLECULAR MARKERS DIGITAL IMAGE ANALYSIS OF ELECTROPHOEROGRAMS CZECH VERSION CLP ANALYSIS OF MOLECULAR MARKERS DIGITAL IMAGE ANALYSIS OF ELECTROPHOEROGRAMS CZECH VERSION DIGITÁLNÍ OBRAZOVÁ ANALÝZA ELEKTROFORETICKÝCH GELŮ *** Vyhodnocování získaných elektroforeogramů: Pro vyhodnocování

Více

Algoritmizace a programování

Algoritmizace a programování Algoritmizace a programování Vyhledávání, vkládání, odstraňování Vyhledání hodnoty v nesetříděném poli Vyhledání hodnoty v setříděném poli Odstranění hodnoty z pole Vkládání hodnoty do pole Verze pro akademický

Více

Molekulární procesy po fertilizacinormální či abnormální po ART?

Molekulární procesy po fertilizacinormální či abnormální po ART? Molekulární procesy po fertilizacinormální či abnormální po ART? Aleš Hampl Již více jak MILION dětí bylo na světě počato pomocí ART ART jako zdroj zvýšeného rizika:? Kongenitální malformace (Ericson and

Více

Úvodem Dříve les než stromy 3 Operace s maticemi

Úvodem Dříve les než stromy 3 Operace s maticemi Obsah 1 Úvodem 13 2 Dříve les než stromy 17 2.1 Nejednoznačnost terminologie 17 2.2 Volba metody analýzy dat 23 2.3 Přehled vybraných vícerozměrných metod 25 2.3.1 Metoda hlavních komponent 26 2.3.2 Faktorová

Více

Induktivní statistika. z-skóry pravděpodobnost

Induktivní statistika. z-skóry pravděpodobnost Induktivní statistika z-skóry pravděpodobnost normální rozdělení Z-skóry umožňují najít a popsat pozici každé hodnoty v rámci rozdělení hodnot a také srovnávání hodnot pocházejících z měření na rozdílných

Více

Modely vyhledávání informací 4 podle technologie. 1) Booleovský model. George Boole 1815 1864. Aplikace booleovské logiky

Modely vyhledávání informací 4 podle technologie. 1) Booleovský model. George Boole 1815 1864. Aplikace booleovské logiky Modely vyhledávání informací 4 podle technologie 1) Booleovský model 1) booleovský 2) vektorový 3) strukturní 4) pravděpodobnostní a další 1 dokumenty a dotazy jsou reprezentovány množinou indexových termů

Více

Molekulární mechanismy diferenciace a programované buněčné smrti - vztah k patologickým procesům buněk. Aleš Hampl

Molekulární mechanismy diferenciace a programované buněčné smrti - vztah k patologickým procesům buněk. Aleš Hampl Molekulární mechanismy diferenciace a programované buněčné smrti - vztah k patologickým procesům buněk Aleš Hampl Tkáně Orgány Živé buňky, které plní různé funkce (podpora struktury, přijímání živin, lokomoce,

Více

STANOVENÍ AMINOKYSELINOVÉHO SLOŽENÍ BÍLKOVIN. Postup stanovení aminokyselinového složení

STANOVENÍ AMINOKYSELINOVÉHO SLOŽENÍ BÍLKOVIN. Postup stanovení aminokyselinového složení STANVENÍ AMINKYSELINVÉH SLŽENÍ BÍLKVIN Důvody pro stanovení AK složení určení nutriční hodnoty potraviny, suroviny (esenciální vs. neesenciální AK) charakterizace určité bílkovinné frakce nebo konkrétní

Více

Vazebné interakce protein s DNA

Vazebné interakce protein s DNA Vazebné interakce protein s DNA Vazebné možnosti vn jší vazba atmosféra + iont kolem nabité DNA vazba ve žlábku van der Waalsovský kontakt s lé ivem ve žlábku interkalace vmeze ení planárního aromat.

Více

Semestrální práce 2 znakový strom

Semestrální práce 2 znakový strom Semestrální práce 2 znakový strom Ondřej Petržilka Datový model BlockFileRecord Bázová abstraktní třída pro záznam ukládaný do blokového souboru RhymeRecord Konkrétní třída záznamu ukládaného do blokového

Více

Interní norma č. 22-102-01/01 Průměr a chlupatost příze

Interní norma č. 22-102-01/01 Průměr a chlupatost příze Předmluva Text vnitřní normy byl vypracován v rámci Výzkumného centra Textil LN00B090 a schválen oponentním řízením dne 7.12.2004. Předmět normy Tato norma stanoví postup měření průměru příze a celkové

Více

KATALOGY RIZIK. Jiří Šejnoha, Eva Novotná, Tomáš Janda, Vladimír Srnec. www.cesti.cz

KATALOGY RIZIK. Jiří Šejnoha, Eva Novotná, Tomáš Janda, Vladimír Srnec. www.cesti.cz KATALOGY RIZIK Jiří Šejnoha, Eva Novotná, Tomáš Janda, Vladimír Srnec WP7 Systémy hospodaření v dopravní infrastruktuře KATALOGY RIZIK Jiří Šejnoha, Eva Novotná, Tomáš Janda, Vladimír Srnec (student) OSNOVA

Více

Abychom obdrželi všechna data za téměř konstantních podmínek, schopných opakování:

Abychom obdrželi všechna data za téměř konstantních podmínek, schopných opakování: 1.0 Vědecké přístupy a získávání dat Měření probíhalo v reálném čase ve snaze získat nejrelevantnější a pravdivá data impulzivní dynamické síly. Bylo rozhodnuto, že tato data budou zachycována přímo z

Více

Metoda Monte Carlo a její aplikace v problematice oceňování technologií. Manuál k programu

Metoda Monte Carlo a její aplikace v problematice oceňování technologií. Manuál k programu Metoda Monte Carlo a její aplikace v problematice oceňování technologií Manuál k programu This software was created under the state subsidy of the Czech Republic within the research and development project

Více

Střední průmyslová škola a Vyšší odborná škola, Hrabákova 271, Příbram. III / 2 = Inovace a zkvalitnění výuky prostřednictvím ICT

Střední průmyslová škola a Vyšší odborná škola, Hrabákova 271, Příbram. III / 2 = Inovace a zkvalitnění výuky prostřednictvím ICT Škola Číslo projektu Číslo a název šablony klíčové aktivity Tematická oblast Název sady Téma Anotace Autor Střední průmyslová škola a Vyšší odborná škola, Hrabákova 271, Příbram CZ.1.07/1.5.00/34.0556

Více

Algoritmy I, složitost

Algoritmy I, složitost A0B36PRI - PROGRAMOVÁNÍ Algoritmy I, složitost České vysoké učení technické Fakulta elektrotechnická v 1.01 Rychlost... Jeden algoritmus (program, postup, metoda ) je rychlejší než druhý. Co ta věta znamená??

Více

Uvolňování parametrů v substitučních modelech (opakování z minula, trochu jinak)

Uvolňování parametrů v substitučních modelech (opakování z minula, trochu jinak) MOLEKULÁRNÍ TAXONOMIE - 6 (2015) Uvolňování parametrů v substitučních modelech (opakování z minula, trochu jinak) Nyní si ukážeme obecný princip, jakým se obohacují substituční modely o parametry tak,

Více

Emergence chování robotických agentů: neuroevoluce

Emergence chování robotických agentů: neuroevoluce Emergence chování robotických agentů: neuroevoluce Petra Vidnerová, Stanislav Slušný, Roman Neruda Ústav Informatiky, AV ČR Kognice a umělý život VIII Praha 28. 5. 2008 Evoluční robotika: EA & neuronové

Více

Obsah přednášky. Analýza algoritmu Algoritmická složitost Návrhy algoritmů Urychlování algoritmů 1/41

Obsah přednášky. Analýza algoritmu Algoritmická složitost Návrhy algoritmů Urychlování algoritmů 1/41 Obsah přednášky Analýza algoritmu Algoritmická složitost Návrhy algoritmů Urychlování algoritmů 1/41 Analýza algoritmu Proč vůbec dělat analýzu? pro většinu problémů existuje několik různých přístupů aby

Více

VÝVOJ ŘÍDICÍCH ALGORITMŮ HYDRAULICKÝCH POHONŮ S VYUŽITÍM SIGNÁLOVÉHO PROCESORU DSPACE

VÝVOJ ŘÍDICÍCH ALGORITMŮ HYDRAULICKÝCH POHONŮ S VYUŽITÍM SIGNÁLOVÉHO PROCESORU DSPACE VÝVOJ ŘÍDICÍCH ALGORITMŮ HYDRAULICKÝCH POHONŮ S VYUŽITÍM SIGNÁLOVÉHO PROCESORU DSPACE Přednáška na semináři CAHP v Praze 4.9.2013 Prof. Ing. Petr Noskievič, CSc. Ing. Miroslav Mahdal, Ph.D. Katedra automatizační

Více

Metodologie pro Informační studia a knihovnictví 2

Metodologie pro Informační studia a knihovnictví 2 Metodologie pro Informační studia a knihovnictví 2 Modul 5: Popis nekategorizovaných dat Co se dozvíte v tomto modulu? Kdy používat modus, průměr a medián. Co je to směrodatná odchylka. Jak popsat distribuci

Více

Národní centrum pro výzkum biomolekul & MetaCentrum

Národní centrum pro výzkum biomolekul & MetaCentrum Masarykova Univerzita Národní centrum pro výzkum biomolekul Národní centrum pro výzkum biomolekul & Petr Kulhánek kulhanek@chemi.muni.cz Národní centrum pro výzkum biomolekul, Masarykova Univerzita Přírodovědecká

Více

Výukový materiál zpracovaný v rámci projektu. Základní škola Sokolov, Běžecká 2055 pracoviště Boženy Němcové 1784

Výukový materiál zpracovaný v rámci projektu. Základní škola Sokolov, Běžecká 2055 pracoviště Boženy Němcové 1784 Výukový materiál zpracovaný v rámci projektu Základní škola Sokolov, Běžecká 2055 pracoviště Boženy Němcové 1784 Název a číslo projektu: Moderní škola, CZ.1.07/1.4.00/21.3331 Šablona: III/2 Inovace a zkvalitnění

Více