Thursday, February 27, 14

Rozměr: px
Začít zobrazení ze stránky:

Download "Thursday, February 27, 14"

Transkript

1

2 DATABÁZE A VYHLEDÁVÁNÍ SEKVENCÍ MOLEKULÁRNÍ TAXONOMIE 2014 MARIAN NOVOTNÝ

3 PŘEDNÁŠEJÍCÍ Mgr. Marian NOVOTNÝ, PhD. vystudoval odbornou biologii na PřF UK, diplomka v laboratoři doc. Folka doktorát na Uppsalské univerzitě se specializací strukturní bioinformatika (Gerard Kleywegt) Marie Curie Fellow na Evropském Bioinformatickém Institutu (Janet Thornton & Roman Laskowski) ornitolog amatér

4 OSNOVA co je substrát pro molekulární taxonomii? kde se shromažďují data? jak data vyhledávat?

5 REKONSTRUKCE EVOLUČNÍ HISTORIE rekonstrukce na základě srovnávání znaků v molekulární taxonomii se používají sekvence sekvence (DNA, RNA, proteiny) se srovnávají tzv. alignmentem

6 KDE NAJÍT SEKVENCE?

7 BIOINFORMATICKÉ DATABÁZE úložiště dat (volně) dostupné pro kohokoliv snadno k nalezení lednové číslo Nucleid Acid Research (NAR)

8 LEDNOVÉ ČÍSLO NAR NUCLEOTIDE SEQUENCE DATABASES RNA SEQUENCE DATABASES PROTEIN SEQUENCE DATABASES STRUCTURE DATABASES GENOMICS DATABASES (NON-VERTEBRATE) METABOLIC AND SIGNALING PATHWAYS HUMAN AND OTHER VERTEBRATE GENOMES HUMAN GENES AND DISEASES MICROARRAY DATA AND OTHER GENE EXPRESSION DATABASES PROTEOMICS RESOURCES OTHER MOLECULAR BIOLOGY DATABASES ORGANELLE DATABASES PLANT DATABASES IMMUNOLOGICAL DATABASES

9 VLASTNOSTI DATABÁZE četnost aktualizace dat četnost aktualizace software redundance anotace dat anotace databáze

10

11

12

13

14 ...A NÁSTROJE

15 DNA DATABÁZE GenBank(NCBI) EMBL (EBI) DDJB (Japonsko)

16 MÁLO ANOTOVANÁ SEKVENCE

17 ANOTOVANÁ SEKVENCE

18

19 GENOMOVÉ DATABÁZE

20

21

22

23 PROTEINOVÉ DATABÁZE Uniprot - Swissprot + TrEMBL - 52,7 mil. sek. Swiss-prot - anotováno, ~ sekvencí GenPept - překládaný GenBank

24 UNIPROT + TREMBL AMINO ACID COMPOSITION 2.1 COMPOSITION IN PERCENT FOR THE COMPLETE DATABASE ALA (A) 8.57 GLN (Q) 3.88 LEU (L) 9.81 SER (S) 6.72 ARG (R) 5.47 GLU (E) 6.14 LYS (K) 5.30 THR (T) 5.61 ASN (N) 4.17 GLY (G) 7.08 MET (M) 2.45 TRP (W) 1.31 ASP (D) 5.28 HIS (H) 2.20 PHE (F) 4.03 TYR (Y) 3.06 CYS (C) 1.29 ILE (I) 6.00 PRO (P) 4.74 VAL (V) 6.71 ASX (B) GLX (Z) XAA (X) 0.06

25

26

27 JAK DATA VYHLEDÁVAT?

28 >ASTAKINE MKMRGVSVGVLVVAMMSGLAMAGSCNSQEPDCGPSECCLQGWMR YSTRGCAPLGEAGSSCNVFTQAPVKGFYIGMCPCRAGLVCTRPSATCQLPSQDNTLDSYY EXISTUJÍ PŘÍBUZNÉ SEKVENCE A KDE JE NAJÍT?

29 HLEDÁNÍ V DATABÁZÍCH - ALGORITMY tradiční algoritmy (Needleman-Wunsch, Smith-Waterman) pomalé pro prohledávání velkých databází používány heuristické metody - rychle vede k výsledku, který se blíží optimálnímu řešení (ale nezaručuje jej) -> pro vyšší rychlost je obětována přesnost (rule of thumb) v případě sekvenčního srovnávání se metoda vzdává jistoty nalezení optimálního alignmentu, aby v krátkém čase provedla srovnání se všemi sekvencemi v databázi (50-100x rychlejší) klasickými heuristickými metodami jsou FASTA a BLAST obě metody použitelné pro DNA i proteinové sekvence

30 FASTA metoda popsaná v 80. letech 20. století (Lipman & Pearson) rychlá, heuristická metoda (na úkor senzitivity), globální alignment zjednodušení v první fázi, sekvence rozděleny na krátké úseky program generuje všechny možné k-tuples o délce k z dané sekvence k = 1-2 pro proteiny, k = 4-6 pro DNA k-tuples jsou porovnávány s k-tuples sekvencí v databázích

31 FASTA hledání SHOD v k-tuples skórováni shod pomocí skórovací tabulky (Blosum 50) a rozšíření alignmentu (bez mezer) vysoce skórující shody vybrány vybere úseky, které budou součástí alignmentu dynamické programování pro konečný alignment (mezery)

32 BLAST BLAST = Basic Local Alignment Search Tool Altschul et al., 1990 sekvence rozděleny na slova (words) a slova skórována vůči databázi všech slov slova skórována skórovací tabulkou (Blosum 62) a jen ty, které dosáhnou předem nadefinovaného minimálního skóre (treshold) jsou dále používány slova se skóre větším než treshold nemusí nutně obsahovat jen shody ( na rozdíl od Fasty) v prvním kroku se porovnávají slova bez mezer

33 BLAST - HSP HSP - high scoring pair vyber jen taková slova, která dosahují alespoň skóre X (treshold) PEG versus PQA PEQ má s Blosum 62 skóre 15, PQA jen 12 pokud si stanovíme treshold 13, tak budeme dále hledat jen slovo PEQ

34 BLAST II takto vybráná slova jsou hledána v databázi modifikovaným Smith- Watermanem (50 x rychlejší) HSP jsou dále rozšiřovány na obě strany dokud skóre roste v posledním kroku jsou nejlépe skórující páry (HSP`s) podrobeny dynamickému programování, které produkuje výsledné skóre a alignment vzhledem k rostoucí velikosti databází je třeba algoritmus neustále modifikovat (dvě shody v okně definované velikosti) obvykle citlivější než FASTA implementován jako server na řadě míst (NCBI, EBI)

35 VERZE BLASTU blastn - hledá s DNA sekvencí (query) v DNA databázi blastp - hledá s proteinovou sekvencí v proteinové databázi blastx - hledá s DNA sekvencí (6 rámců) v proteinové databázi tblastn - hledá s proteinovou sekvencí v DNA databázi tblastx - překládaná DNA v překládané DNA databázi megablast - víc query najednou

36

37

38 BLAST - VÝBĚR databáze - DNA x protein, anotovaná x kompletní, strukturní, genomové, specializované (protilátky)... organismus datum - sekvence za poslední dva týdny skórovací tabulka - blosum 62 velikost slova low-complexity region filter - často P, D, N, E - false positive default nastavení algoritmu vhodné ve většině případů

39 BLOSUM BLOSUM 80 - tabulka vypočítaná na základě alignmentu bloku sekvencí s identitou 80 % BLOSUM 62 - tabulka vypočítaná na základě alignmentu bloku sekvencí s identitou 62 %

40 BLOSUM VERSUS PAM PAM 10 BLOSUM 90 PAM 250 BLOSUM 62 VELMI PŘÍBUZNÍ VZDÁLENĚ PŘÍBUZNÍ

41 VÝZNAMNOST NÁLEZU optimální alignment lze nalézt pro jakékoliv dvě sekvence dvě náhodné DNA sekvence = ~ 25% SI dvě náhodné proteinové sekvence = ~ 5% SI jak určit, že je alignment statisticky významný?

42 PARAMETRY VÝZNAMNOSTI P-value E-value pouze statistická významnost skóre -> biologickou relevanci záhodno ověřovat experimentálně

43 P-VALUE P-value - pravděpodobnost, že sekvence budou srovnány s nalezeným nebo vyšším skóre a zároveň nebudou příbuzné (false positive hit) P-value - pravděpodobnost, že bude skóre x nebo vyššího dosaženo náhodou pro účely výpočtu lze náhodu simulovat přeskládáváním sekvencí nebo výběrem vzorku z databáze druhá možnost lépe odpovídá realitě a poskytuje lepší výsledky (především u DNA)

44 EVD rozložení skóre lokálních alignmentů nepříbuzných sekvencí neodpovídá normálnímu rozdělení, ale rozdělení podle extrémních hodnot (EVD) při normálním rozdělení by docházelo k přeceňování významu dosažených skóre DUNDAS ET AL. BMC BIOINFORMATICS 2007

45 P-VALUE P-value (S>x) = 1-exp (-exp (-λ(x-u))), u = charakteristická hodnota = Kmn/λ m,n = délky sekvencí; K = konstanta; λ = decay factor K a λ mohou být kalkulovány z vlastností skórovací tabulky

46 E-VALUE E-value = pravděpodobnost, že bude dosaženo skóre x nebo vyššího náhodou v databázi dané velikosti E-value = P-value x N ; velikost databáze příklad: databáze o miliónu sekvencí a P-value = 10-6 cutoff (expect treshold) parametr v BLASTU - udává kolik lze průměrně očekávat false positives v databázi dané velikosti -> způsob jak vyvažovat senzitivitu a selektivitu nižší hodnota cutoff zvyšuje selektivitu, ale snižuje senzitivitu

47 E-VALUE E-value = pravděpodobnost, že bude dosaženo skóre x nebo vyššího náhodou v databázi dané velikosti E-value = P-value x N ; velikost databáze příklad: databáze o miliónu sekvencí a P-value = 10-6 E-value = 10-6 x 10 6 =1 cutoff (expect treshold) parametr v BLASTU - udává kolik lze průměrně očekávat false positives v databázi dané velikosti -> způsob jak vyvažovat senzitivitu a selektivitu nižší hodnota cutoff zvyšuje selektivitu, ale snižuje senzitivitu

48 BLAST / EVOLUČNÍ VZDÁLENOST říká nám BLAST něco o příbuznosti nalezených sekvencí? Je první hit evolučně nejpříbuznější query (hledané sekvenci)?

49 BLAST / EVOLUČNÍ VZDÁLENOST říká nám BLAST něco o příbuznosti nalezených sekvencí? Je první hit evolučně nejpříbuznější query (hledané sekvenci)? BLAST většinou nalezá příbuzné sekvence nejpříbuznější sekvence však mohou chybět v databázi lokální alignment - často skóruje nejlépe vzdálené příbuzné 7 % sekvencí E.coli mělo nejlépe skórující sekvenci mimo Bacteria

50

51

52 2JTK

53 SEQUENCE IDENTITA/HOMOLOGIE NEHOMOLOGNÍ PROTEINY ROST, 1999

54 SEQUENCE IDENTITA/HOMOLOGIE HOMOLOGNÍ PROTEINY ROST, 1999

55 SEQUENCE IDENTITA/HOMOLOGIE sekvenční identita > 35% - pravděpodobně homolog sekvenční identita = 20-35% ( twilight zone ; Doolittle) - může být homolog sekvenční identita < 20% - midnight zone (Rost) - sekvence zcela nedostatečná k určení homologie

56 SANDER ET AL., PREPRINT Average sequence identity of random alignments % Average sequence identity of remote homologues %

57 SSEARCH pokud máte moře času nebo počítačový klastr nebo jste zoufalí rigorózní Smith-Waterman - local alignment v databázi

58 DALŠÍ METODY HLEDÁNÍ V DATABÁZÍCH profilové metody HMM modely

59 PROFILY modifikují skórovací tabulky specificky pro skupiny proteinů a pozici v alignmentu (např. globiny) pro každou pozici v alignmentu jsou generovány specifická skóre jak pro záměnu za jakoukoliv aa, tak pro inzerci nebo deleci Prof (pos,aa) = Σtype N(pos,type) x S(type, aa) x 10 N(pos,type) = podíl výskytu aa x na pozici y S(type, aa) = skóre skórovací tabulky pro zaměňovaný pár

60 PŘÍKLAD PROFILU v alignmentu globinů se na pozici 3 vyskytuje 3x Ala, 6x Val, 1x Ile, používáme tabulku Blosum 62 jaké bude profilové skóre pro výskyt Ile a His? N(x,A) = 0.3, N(x,V) = 0.6, N(x, I) = 0.1 S(A,I) = -1, S(V,I) = 3, S(I,I) = 4 S(A,H) = -2, S(V,H) = -3, S(I,H) = -3 Prof (x, I) = 0.3 x x x 4 = 2.1 x 10 (v profilu) = 21 ( -1, 3, 4) Prof (x, H) = 0.3 x x x -3 = -2.7 x 10 = -27 (-2, -3, -3)

61 PSI-BLAST PSI-BLAST = Position Specific Iterative Blast Altschul et al., 1997 profilová metoda, používá Position Specific Scoring Matrix (PSSM) v prvním kole klasický BLAST, z vysoko skórujících alignmentů je generována PSSM v dalším kole hledání je už použita nová matrice a následně znovu generována nová PSSM opakováno libovolně dlouho (až ke konvergenci) benchmark metoda

62 HMM HMM = Hidden Markov Model profilová metoda, používána při rozhodování, zda protein spadá do jisté skupiny proteinů, typicky pro sekvence s nízkou %SI velmi citlivá metoda, která vytváří statistický model pro definovanou skupinu sekvencí na základě tréninku na sekvencích patřících do jedné skupiny (globiny) generuje pravděpodobnost nejen pro jednotlivé záměny a inzerce a delece, ale i pro přechody mezi nima dovede do modelu zahrnout i aminokyseliny, které se v tréninkové skupině nevyskytují alignment s největší pravděpodobností je optimální posuzuje jak dobře daná sekvence odpovídá modelu

63 HMM

64 SHRNUTÍ databáze by měly být pravidelně updatovány přehled dostupných biologických databází vždy v lednovém čísle NAR řada velmi specializovaných databází hledání v databázích povětšinou heuristickými metodami standard dnes BLAST nutno hodnotit statistickou významnost nálezu citlivější metodou PSI-Blast nebo HMM metody

DATABÁZE A VYHLEDÁVÁNÍ SEKVENCÍ

DATABÁZE A VYHLEDÁVÁNÍ SEKVENCÍ DATABÁZE A VYHLEDÁVÁNÍ SEKVENCÍ MOLEKULÁRNÍ TAXONOMIE 2015 MARIAN NOVOTNÝ OSNOVA co je substrát pro molekulární taxonomii? kde se shromažďují data? jak data vyhledávat? REKONSTRUKCE EVOLUČNÍ HISTORIE rekonstrukce

Více

Studijní materiály pro bioinformatickou část ViBuChu. úloha II. Jan Komárek, Gabriel Demo

Studijní materiály pro bioinformatickou část ViBuChu. úloha II. Jan Komárek, Gabriel Demo Studijní materiály pro bioinformatickou část ViBuChu úloha II Jan Komárek, Gabriel Demo Adenin Struktura DNA Thymin 5 konec 3 konec DNA tvořena dvěmi řetězci orientovanými antiparalelně (liší se orientací

Více

Vyhledávání podobných sekvencí BLAST

Vyhledávání podobných sekvencí BLAST Vyhledávání podobných sekvencí BLAST Základní informace Následující text je součástí učebních textů předmětu Analýza sekvencí DNA a je určen hlavně pro studenty Matematické biologie. Může být ovšem přínosný

Více

Evropský sociální fond Praha & EU: Investujeme do vaší budoucnosti URČOVÁNÍ PRIMÁRNÍ STRUKTURY BÍLKOVIN

Evropský sociální fond Praha & EU: Investujeme do vaší budoucnosti URČOVÁNÍ PRIMÁRNÍ STRUKTURY BÍLKOVIN Evropský sociální fond Praha & EU: Investujeme do vaší budoucnosti URČOVÁNÍ PRIMÁRNÍ STRUKTURY BÍLKOVIN Primární struktura primární struktura bílkoviny je dána pořadím AK jejích polypeptidových řetězců

Více

Inovace studia molekulární a buněčné biologie

Inovace studia molekulární a buněčné biologie Inovace studia molekulární a buněčné biologie Tento projekt je spolufinancován Evropským sociálním fondem a státním rozpočtem České republiky. MBIO1/Molekulární biologie 1 Tento projekt je spolufinancován

Více

Využití internetových zdrojů při studiu mikroorganismů

Využití internetových zdrojů při studiu mikroorganismů Využití internetových zdrojů při studiu mikroorganismů doc. RNDr. Milan Bartoš, Ph.D. bartosm@vfu.cz Přírodovědecká fakulta MU, 2012 Obsah přednášky 1) Práce se sekvenčními daty 2) Základní veřejně dostupné

Více

Genomické databáze. Shlukování proteinových sekvencí. Ivana Rudolfová. školitel: doc. Ing. Jaroslav Zendulka, CSc.

Genomické databáze. Shlukování proteinových sekvencí. Ivana Rudolfová. školitel: doc. Ing. Jaroslav Zendulka, CSc. Genomické databáze Shlukování proteinových sekvencí Ivana Rudolfová školitel: doc. Ing. Jaroslav Zendulka, CSc. Obsah Proteiny Zdroje dat Predikce struktury proteinů Cíle disertační práce Vstupní data

Více

Bioinformatika a funkční studie

Bioinformatika a funkční studie Bioinformatika a funkční studie Bioinformatika Vztah informace a funkce Sekvenování DNA Proteinů Databáze Primární Sekundární Integrované internetové zdroje informací Vyhledávání sekvenční podobnosti,

Více

Proteiny Genová exprese. 2013 Doc. MVDr. Eva Bártová, Ph.D.

Proteiny Genová exprese. 2013 Doc. MVDr. Eva Bártová, Ph.D. Proteiny Genová exprese 2013 Doc. MVDr. Eva Bártová, Ph.D. Bílkoviny (proteiny), 15% 1g = 17 kj Monomer = aminokyseliny aminová skupina karboxylová skupina α -uhlík postranní řetězec Znát obecný vzorec

Více

Hemoglobin a jemu podobní... Studijní materiál. Jan Komárek

Hemoglobin a jemu podobní... Studijní materiál. Jan Komárek Hemoglobin a jemu podobní... Studijní materiál Jan Komárek Bioinformatika Bioinformatika je vědní disciplína, která se zabývá metodami pro shromážďování, analýzu a vizualizaci rozsáhlých souborů biologických

Více

Bioinformatika a výpočetní biologie KFC/BIN. I. Přehled

Bioinformatika a výpočetní biologie KFC/BIN. I. Přehled Bioinformatika a výpočetní biologie KFC/BIN I. Přehled RNDr. Karel Berka, Ph.D. Univerzita Palackého v Olomouci Definice bioinformatiky (Molecular) bio informatics: bioinformatics is conceptualising biology

Více

Aminokyseliny příručka pro učitele. Obecné informace: Téma otevírá kapitolu Bílkoviny, která svým rozsahem překračuje rámec jedné vyučovací hodiny.

Aminokyseliny příručka pro učitele. Obecné informace: Téma otevírá kapitolu Bílkoviny, která svým rozsahem překračuje rámec jedné vyučovací hodiny. Obecné informace: Aminokyseliny příručka pro učitele Téma otevírá kapitolu Bílkoviny, která svým rozsahem překračuje rámec jedné vyučovací hodiny. Navazující učivo Před probráním tématu Aminokyseliny probereme

Více

Osekvenované genomy. Pan troglodydes, 2005. Neandrtálec, 2010

Osekvenované genomy. Pan troglodydes, 2005. Neandrtálec, 2010 GENOMOVÉ PROJEKTY Osekvenované genomy Haemophilus influenze, 1995 první osekvenovaná bakterie Saccharomyces cerevisiae, 1996 první osekvenovaný eukaryotický organimus Caenorhabditis elegans, 1998 první

Více

Metabolismus bílkovin. Václav Pelouch

Metabolismus bílkovin. Václav Pelouch ZÁKLADY OBECNÉ A KLINICKÉ BIOCHEMIE 2004 Metabolismus bílkovin Václav Pelouch kapitola ve skriptech - 3.2 Výživa Vyvážená strava člověka musí obsahovat: cukry (50 55 %) tuky (30 %) bílkoviny (15 20 %)

Více

Co se o sobě dovídáme z naší genetické informace

Co se o sobě dovídáme z naší genetické informace Genomika a bioinformatika Co se o sobě dovídáme z naší genetické informace Jan Pačes, Mgr, Ph.D Ústav molekulární genetiky AVČR, CZECH FOBIA (Free and Open Bioinformatics Association) hpaces@img.cas.cz

Více

Metabolismus aminokyselin. Vladimíra Kvasnicová

Metabolismus aminokyselin. Vladimíra Kvasnicová Metabolismus aminokyselin Vladimíra Kvasnicová Aminokyseliny aminokyseliny přijímáme v potravě ve formě proteinů: důležitá forma organicky vázaného dusíku, který tak může být v těle využit k syntéze dalších

Více

Aminokyseliny. Gymnázium a Jazyková škola s právem státní jazykové zkoušky Zlín. Tematická oblast Datum vytvoření Ročník Stručný obsah Způsob využití

Aminokyseliny. Gymnázium a Jazyková škola s právem státní jazykové zkoušky Zlín. Tematická oblast Datum vytvoření Ročník Stručný obsah Způsob využití Aminokyseliny Tematická oblast Datum vytvoření Ročník Stručný obsah Způsob využití Autor Kód Chemie přírodních látek proteiny 18.7.2012 3. ročník čtyřletého G Určování postranních řetězců aminokyselin

Více

Využití strojového učení k identifikaci protein-ligand aktivních míst

Využití strojového učení k identifikaci protein-ligand aktivních míst Využití strojového učení k identifikaci protein-ligand aktivních míst David Hoksza, Radoslav Krivák SIRET Research Group Katedra softwarového inženýrství, Matematicko-fyzikální fakulta Karlova Univerzita

Více

ÚVOD DO BIOINFORMATIKY

ÚVOD DO BIOINFORMATIKY MSSSYITDQGPGSGLRVPARSWLNSDAPSLSLNGDWRFRLLPTAPGTPGAGSVLATGETVEAVASESFD DSSWDTLAVPSHWVLAEDGKYGRPIYTNVQYPFPIDPPFVPDANPTGDYRRTFDVPDSWFESTTAALTL RFDGVESRYKVWVNGVEIGVGSGSRLAQEFDVSEALRPGKNLLVVRVHQWSAASYLEDQDQWWLPGIFR

Více

Aplikovaná bioinformatika

Aplikovaná bioinformatika Aplikovaná bioinformatika Číslo aktivity: 2.V Název klíčové aktivity: Na realizaci se podílí: Implementace nových předmětů do daného studijního programu doc. RNDr. Michaela Wimmerová, Ph.D., Mgr. Josef

Více

Bioinformatika. Jiří Vondrášek Ústav organické chemie a biochemie Jan Pačes Ústav molekulární genetiky

Bioinformatika. Jiří Vondrášek Ústav organické chemie a biochemie Jan Pačes Ústav molekulární genetiky Bioinformatika pro PrfUK 2006 Jiří Vondrášek Ústav organické chemie a biochemie vondrasek@uochb.cas.cz Jan Pačes Ústav molekulární genetiky hpaces@img.cas.cz http://bio.img.cas.cz/prfuk2006 syllabus Úterý,

Více

Bioinformatika pro PrfUK 2003

Bioinformatika pro PrfUK 2003 Bioinformatika pro PrfUK 2003 Jiří Vondrášek Ústav organické chemie a biochemie vondrasek@uochb.cas.cz Jan Pačes Ústav molekulární genetiky hpaces@img.cas.cz http://bio.img.cas.cz/prfuk2003 What is Bioinformatics?---The

Více

Biologie. Autorské řešení kvalifikační úlohy

Biologie. Autorské řešení kvalifikační úlohy Biologie Autorské řešení kvalifikační úlohy Přepis sekvence ze sekvenátoru A C G T 5' C G T T C T A T A G A T A C G C G A T G A C G G T A T A C C A T C C G C A A A G T 3' http://blast.ncbi.nlm.nih.gov/

Více

Počítačová analýza lokálních podobností mezi biologickými sekvencemi

Počítačová analýza lokálních podobností mezi biologickými sekvencemi MASARYKOVA UNIVERZITA V BRNĚ Fakulta informatiky Michal VAVERKA Počítačová analýza lokálních podobností mezi biologickými sekvencemi Bakalářská práce Vedoucí práce: Ing. Matej Lexa, Ph.D. Brno 2006 Prohlašuji,

Více

Pravděpodobnost v závislosti na proměnné x je zde modelován pomocí logistického modelu. exp x. x x x. log 1

Pravděpodobnost v závislosti na proměnné x je zde modelován pomocí logistického modelu. exp x. x x x. log 1 Logistická regrese Menu: QCExpert Regrese Logistická Modul Logistická regrese umožňuje analýzu dat, kdy odezva je binární, nebo frekvenční veličina vyjádřená hodnotami 0 nebo 1, případně poměry v intervalu

Více

jednoduchá heuristika asymetrické okolí stavový prostor, kde nelze zabloudit připustit zhoršují cí tahy Pokročilé heuristiky

jednoduchá heuristika asymetrické okolí stavový prostor, kde nelze zabloudit připustit zhoršují cí tahy Pokročilé heuristiky Pokročilé heuristiky jednoduchá heuristika asymetrické stavový prostor, kde nelze zabloudit připustit zhoršují cí tahy pokročilá heuristika symetrické stavový prostor, který vyžaduje řízení 1 2 Paměť pouze

Více

Bioinformatika. hledání významu biologických dat. Marian Novotný. Friday, April 24, 15

Bioinformatika. hledání významu biologických dat. Marian Novotný. Friday, April 24, 15 Bioinformatika hledání významu biologických dat Marian Novotný Bioinformatika sběr biologických dat archivace biologických dat organizace biologických dat interpretace biologických dat 2 Biologové sbírají

Více

Metabolismus aminokyselin 2. Vladimíra Kvasnicová

Metabolismus aminokyselin 2. Vladimíra Kvasnicová Metabolismus aminokyselin 2 Vladimíra Kvasnicová Odbourávání AMK 1) odstranění aminodusíku z molekuly AMK 2) detoxikace uvolněné aminoskupiny 3) metabolismus uhlíkaté kostry AMK 7 produktů 7 degradačních

Více

Struktury a vazebné energie iontových klastrů helia

Struktury a vazebné energie iontových klastrů helia Společný seminář 11. června 2012 Struktury a vazebné energie iontových klastrů helia Autor: Lukáš Červenka Vedoucí práce: Doc. RNDr. René Kalus, Ph.D. Technický úvod Existují ověřené optimalizační algoritmy

Více

Využití DNA sekvencování v

Využití DNA sekvencování v Využití DNA sekvencování v taxonomii prokaryot Mgr. Pavla Holochová, doc. RNDr. Ivo Sedláček, CSc. Česká sbírka mikroorganismů Ústav experimentální biologie Přírodovědecká fakulta Masarykova univerzita,

Více

Vyhledávání příbuzných enzymů s modifikovanou funkcí v proteinových databázích

Vyhledávání příbuzných enzymů s modifikovanou funkcí v proteinových databázích 2015 http://excel.fit.vutbr.cz Vyhledávání příbuzných enzymů s modifikovanou funkcí v proteinových databázích Jiří Hon* Abstrakt Hledání příbuzných enzymů v biologických databázích patří mezi obvyklé činnosti

Více

11. Tabu prohledávání

11. Tabu prohledávání Jan Schmidt 2011 Katedra číslicového návrhu Fakulta informačních technologií České vysoké učení technické v Praze Zimní semestr 2011/12 MI-PAA EVROPSKÝ SOCIÁLNÍ FOND PRAHA & EU: INVESTUJENE DO VAŠÍ BUDOUCNOSTI

Více

PREDIKTOR VLIVU AMINOKYSELINOVÝCH SUBSTITUCÍ NA FUNKCI PROTEINŮ

PREDIKTOR VLIVU AMINOKYSELINOVÝCH SUBSTITUCÍ NA FUNKCI PROTEINŮ VYSOKÉ UČENÍ TECHNICKÉ V BRNĚ BRNO UNIVERSITY OF TECHNOLOGY FAKULTA INFORMAČNÍCH TECHNOLOGIÍ ÚSTAV INFORMAČNÍCH SYSTÉMŮ FACULTY OF INFORMATION TECHNOLOGY DEPARTMENT OF INFORMATION SYSTEMS PREDIKTOR VLIVU

Více

Služby pro predikci struktury proteinů. Josef Pihera

Služby pro predikci struktury proteinů. Josef Pihera Služby pro predikci struktury proteinů Josef Pihera Struktura proteinů Primární sekvence aminokyselin Sekundární stáčení a spojování vodíkovými vazbami Supersekundární struktura přechod, opakovaná geometrická

Více

VYSOKÉ UČENÍ TECHNICKÉ V BRNĚ VYHLEDÁVÁNÍ HOMOLOGNÍCH GENŮ DIPLOMOVÁ PRÁCE

VYSOKÉ UČENÍ TECHNICKÉ V BRNĚ VYHLEDÁVÁNÍ HOMOLOGNÍCH GENŮ DIPLOMOVÁ PRÁCE VYSOKÉ UČENÍ TECHNICKÉ V BRNĚ BRNO UNIVERSITY OF TECHNOLOGY FAKULTA ELEKTROTECHNIKY A KOMUNIKAČNÍCH TECHNOLOGIÍ ÚSTAV BIOMEDICÍNSKÉHO INŽENÝRSTVÍ FACULTY OF ELECTRICAL ENGINEERING AND COMMUNICATION DEPARTMENT

Více

E-infrastruktura CESNET - partner výzkumné infrastruktury pro biologická data ELIXIR CZ

E-infrastruktura CESNET - partner výzkumné infrastruktury pro biologická data ELIXIR CZ E-infrastruktura CESNET - partner výzkumné infrastruktury pro biologická data ELIXIR CZ Life Science - od molekul k systému Slovník komponent Gramatika (interakce) Souvislosti a sítě (diagramy ) Atlas

Více

Bioinformatika. Alignment 2. http://bio.img.cas.cz. Jiří Vondrášek Ústav organické chemie a biochemie vondrasek@uochb.cas.cz

Bioinformatika. Alignment 2. http://bio.img.cas.cz. Jiří Vondrášek Ústav organické chemie a biochemie vondrasek@uochb.cas.cz Bioinformatika lignment http://bio.img.cas.cz Jiří Vondrášek Ústav organické chemie a biochemie vondrasek@uochb.cas.cz Jan Pačes Ústav molekulární genetiky hpaces@img.cas.cz typy alignmentů : :n n:n n

Více

Statistické metody v ekonomii. Ing. Michael Rost, Ph.D.

Statistické metody v ekonomii. Ing. Michael Rost, Ph.D. Statistické metody v ekonomii Ing. Michael Rost, Ph.D. Jihočeská univerzita v Českých Budějovicích Test χ 2 v kontingenční tabulce typu 2 2 Jde vlastně o speciální případ χ 2 testu pro čtyřpolní tabulku.

Více

7 Další. úlohy analýzy řeči i a metody

7 Další. úlohy analýzy řeči i a metody Pokročilé metody rozpoznávánířeči Přednáška 7 Další úlohy analýzy řeči i a metody jejich řešení Výsledky rozpoznávání (slovník k 413k) frantisek_vlas 91.92( 90.18) [H= 796, D= 10, S= 60, I= 15, N=866,

Více

Molekulárn. rní genetika

Molekulárn. rní genetika Molekulárn rní genetika Centráln lní dogma molekulárn rní biologie cesta přenosu genetické informace: DNA RNA proteiny výjimkou reverzní transkripce retrovirů: RNA DNA Chemie nukleových kyselin dusíkaté

Více

6. Kde v DNA nalézáme rozdíly, zodpovědné za obrovskou diverzitu života?

6. Kde v DNA nalézáme rozdíly, zodpovědné za obrovskou diverzitu života? 6. Kde v DNA nalézáme rozdíly, zodpovědné za obrovskou diverzitu života? Pamatujete na to, co se objevilo v pracích Charlese Darwina a Alfreda Wallace ohledně vývoje druhů? Aby mohl mechanismus přírodního

Více

Inovace studia molekulární a buněčné biologie

Inovace studia molekulární a buněčné biologie Inovace studia molekulární a buněčné biologie Tento projekt je spolufinancován Evropským sociálním fondem a státním rozpočtem České republiky. MBIO1/Molekulární biologie 1 Tento projekt je spolufinancován

Více

Výuka genetiky na Přírodovědecké fakultě UK v Praze

Výuka genetiky na Přírodovědecké fakultě UK v Praze Výuka genetiky na Přírodovědecké fakultě UK v Praze Studium biologie na PřF UK v Praze Bakalářské studijní programy / obory Biologie Biologie ( duhový bakalář ) Ekologická a evoluční biologie ( zelený

Více

Biotechnologický kurz. II. letní škola metod molekulární biologie nukleových kyselin a genomiky 17. - 21. 6. 2013

Biotechnologický kurz. II. letní škola metod molekulární biologie nukleových kyselin a genomiky 17. - 21. 6. 2013 Biotechnologický kurz Biotechnologický kurz II. letní škola metod molekulární biologie nukleových kyselin a genomiky 17. - 21. 6. 2013 Ústav morfologie, fyziologie a genetiky zvířat AF MENDELU v Brně Zemědělská

Více

Doprovodný materiál k práci s přípravným textem Biologické olympiády 2014/2015 pro soutěžící a organizátory kategorie B

Doprovodný materiál k práci s přípravným textem Biologické olympiády 2014/2015 pro soutěžící a organizátory kategorie B Doprovodný materiál k práci s přípravným textem Biologické olympiády 2014/2015 pro soutěžící a organizátory kategorie B Níže uvedené komentáře by měly pomoci soutěžícím z kategorie B ke snazší orientaci

Více

V. letní škola metod molekulární biologie nukleových kyselin a genomiky 16. - 20. 6. 2014. Ústav morfologie, fyziologie a genetiky zvířat AF MENDELU

V. letní škola metod molekulární biologie nukleových kyselin a genomiky 16. - 20. 6. 2014. Ústav morfologie, fyziologie a genetiky zvířat AF MENDELU V. letní škola metod molekulární biologie nukleových kyselin a genomiky 16. - 20. 6. 2014 Ústav morfologie, fyziologie a genetiky zvířat AF MENDELU Zemědělská 1, Budova A, 4. patro (učebny dle programu)

Více

Biotechnologický kurz. III. letní škola metod molekulární biologie nukleových kyselin a genomiky

Biotechnologický kurz. III. letní škola metod molekulární biologie nukleových kyselin a genomiky Biotechnologický kurz Biotechnologický kurz III. letní škola metod molekulární biologie nukleových kyselin a genomiky 18. - 22. 6. 2012 Ústav morfologie, fyziologie a genetiky zvířat AF MENDELU v Brně

Více

BIOSTIMULÁTOR AGRO-SORB ZDRAVÍ PRO POLE. VP AGRO, spol. s.r.o. Stehlíkova , Praha 6 - Suchdol

BIOSTIMULÁTOR AGRO-SORB ZDRAVÍ PRO POLE. VP AGRO, spol. s.r.o. Stehlíkova , Praha 6 - Suchdol BIOSTIMULÁTOR AGRO-SORB ZDRAVÍ PRO POLE VP AGRO, spol. s.r.o. Stehlíkova 977 165 00, Praha 6 - Suchdol 18 volných aminokyselin (L- alfa) 18 volných aminokyselin (L- alfa) 18 volných aminokyselin (L- alfa)

Více

Dobývání znalostí. Doc. RNDr. Iveta Mrázová, CSc. Katedra teoretické informatiky Matematicko-fyzikální fakulta Univerzity Karlovy v Praze

Dobývání znalostí. Doc. RNDr. Iveta Mrázová, CSc. Katedra teoretické informatiky Matematicko-fyzikální fakulta Univerzity Karlovy v Praze Dobývání znalostí Doc. RNDr. Iveta Mrázová, CSc. Katedra teoretické informatiky Matematicko-fyzikální fakulta Univerzity Karlovy v Praze Dobývání znalostí Pravděpodobnost a učení Doc. RNDr. Iveta Mrázová,

Více

Bílkoviny - proteiny

Bílkoviny - proteiny Bílkoviny - proteiny Proteiny jsou složeny z 20 kódovaných aminokyselin L-enantiomery Chemická struktura aminokyselin R představuje jeden z 20 různých typů postranních řetězců R Hlavní řetězec je neměnný

Více

PRODUKTY. Tovek Tools

PRODUKTY. Tovek Tools jsou desktopovou aplikací určenou k vyhledávání informací, tvorbě různých typů analýz a vytváření přehledů a rešerší. Jsou vhodné pro práci i s velkým objemem textových dat z různorodých informačních zdrojů.

Více

Názvosloví cukrů, tuků, bílkovin

Názvosloví cukrů, tuků, bílkovin Názvosloví cukrů, tuků, bílkovin SACARIDY CUKRY MNSACARIDY LIGSACARIDY PLYSACARIDY (z mnoha molekul monosacharidů) ALDSY KETSY -DISACARIDY - TRISACARIDY - TETRASACARIDY atd. -aldotriosy -aldotetrosy -aldopentosy

Více

Vojtěch Franc. Biometrie ZS Poděkování Janu Šochmanovi za slajdy vysvětlující AdaBoost

Vojtěch Franc. Biometrie ZS Poděkování Janu Šochmanovi za slajdy vysvětlující AdaBoost Rozpoznávání tváří I Vojtěch Franc Centrum strojového vnímání, ČVUT FEL Praha Biometrie ZS 2013 Poděkování Janu Šochmanovi za slajdy vysvětlující AdaBoost Úlohy rozpoznávání tváří: Detekce Cíl: lokalizovat

Více

PODOBNOSTI PRIMÁRNÍ STRUKTURY

PODOBNOSTI PRIMÁRNÍ STRUKTURY VYSOKÉ UČENÍ TECHNICKÉ V BRNĚ BRNO UNIVERSITY OF TECHNOLOGY FAKULTA INFORMAČNÍCH TECHNOLOGIÍ ÚSTAV INFORMAČNÍCH SYSTÉMŮ FACULTY OF INFORMATION TECHNOLOGY DEPARTMENT OF INFORMATION SYSTEMS SHLUKOVÁNÍ PROTEINOVÝCH

Více

Vzdělávací materiál. vytvořený v projektu OP VK. Anotace. Název školy: Gymnázium, Zábřeh, náměstí Osvobození 20. Číslo projektu:

Vzdělávací materiál. vytvořený v projektu OP VK. Anotace. Název školy: Gymnázium, Zábřeh, náměstí Osvobození 20. Číslo projektu: Vzdělávací materiál vytvořený v projektu P VK Název školy: Gymnázium, Zábřeh, náměstí svobození 20 Číslo projektu: Název projektu: Číslo a název klíčové aktivity: CZ.1.07/1.5.00/34.0211 Zlepšení podmínek

Více

Gibbsovo samplování a jeho využití

Gibbsovo samplování a jeho využití Gibbsovo samplování a jeho využití Regulace genů Hlavní pozornost výzkumů DNA je většinou věnována analýze genů Geny tvoří pouhá 3% lidské DNA Ukazuje se, že zbývající junk DNA má také velký význam Obsahuje

Více

Využití metagenomiky při hodnocení sanace chlorovaných ethylenů in situ Výsledky pilotních testů

Využití metagenomiky při hodnocení sanace chlorovaných ethylenů in situ Výsledky pilotních testů Využití metagenomiky při hodnocení sanace chlorovaných ethylenů in situ Výsledky pilotních testů Stavělová M.,* Macháčková J.*, Rídl J.,** Pačes J.** * Earth Tech CZ, s.r.o ** ÚMG AV ČR PROČ METAGENOMIKA?

Více

Vyhledávání nebo nalezení informací

Vyhledávání nebo nalezení informací Vyhledávání nebo nalezení informací Vilém Sklenák sklenak@vse.cz Vysoká škola ekonomická, fakulta informatiky a statistiky, katedra informačního a znalostního inženýrství Inforum2012, 23. 5. 2012 Vilém

Více

Struktura a funkce biomakromolekul

Struktura a funkce biomakromolekul Struktura a funkce biomakromolekul KBC/BPOL 7. Interakce DNA/RNA - protein Ivo Frébort Interakce DNA/RNA - proteiny v buňce Základní dogma molekulární biologie Replikace DNA v E. coli DNA polymerasa a

Více

Maturitní otázky z předmětu PROGRAMOVÁNÍ

Maturitní otázky z předmětu PROGRAMOVÁNÍ Wichterlovo gymnázium, Ostrava-Poruba, příspěvková organizace Maturitní otázky z předmětu PROGRAMOVÁNÍ 1. Algoritmus a jeho vlastnosti algoritmus a jeho vlastnosti, formy zápisu algoritmu ověřování správnosti

Více

Populační genetika. ) a. Populační genetika. Castle-Hardy-Weinbergova zákonitost. Platí v panmiktické populaci za předpokladu omezujících podmínek

Populační genetika. ) a. Populační genetika. Castle-Hardy-Weinbergova zákonitost. Platí v panmiktické populaci za předpokladu omezujících podmínek Poulační genetika Poulační genetika ORGANISMUS Součást výše organizované soustavy oulace POPULACE Soubor jedinců jednoho druhu Genotyově heterogenní V určitém čase má řirozeně vymezený rostor Velký očet

Více

NMR biomakromolekul RCSB PDB. Progr. NMR

NMR biomakromolekul RCSB PDB. Progr. NMR NMR biomakromolekul Typy biomakromolekul a možnosti studia pomocí NMR proteiny a peptidy rozmanité složení, omezení jen velikostí molekul nukleové kyseliny (RNA, DNA) a oligonukleotidy omezení malou rozmanitostí

Více

ČVUT FEL X36PAA - Problémy a algoritmy. 4. úloha - Experimentální hodnocení algoritmů pro řešení problému batohu

ČVUT FEL X36PAA - Problémy a algoritmy. 4. úloha - Experimentální hodnocení algoritmů pro řešení problému batohu ČVUT FEL X36PAA - Problémy a algoritmy 4. úloha - Experimentální hodnocení algoritmů pro řešení problému batohu Jméno: Marek Handl Datum: 3. 2. 29 Cvičení: Pondělí 9: Zadání Prozkoumejte citlivost metod

Více

LEKCE 5 STATISTICKÁ INFERENCE ANEB ZOBECŇOVÁNÍ VÝSLEDKŮ Z VÝBĚROVÉHO NA ZÁKLADNÍ SOUBOR

LEKCE 5 STATISTICKÁ INFERENCE ANEB ZOBECŇOVÁNÍ VÝSLEDKŮ Z VÝBĚROVÉHO NA ZÁKLADNÍ SOUBOR LEKCE 5 STATISTICKÁ INFERENCE ANEB ZOBECŇOVÁNÍ VÝSLEDKŮ Z VÝBĚROVÉHO NA ZÁKLADNÍ SOUBOR Ve většině případů pracujeme s výběrovým souborem a výběrové výsledky zobecňujeme na základní soubor. Smysluplné

Více

Inovace bakalářského studijního oboru Aplikovaná chemie http://aplchem.upol.cz

Inovace bakalářského studijního oboru Aplikovaná chemie http://aplchem.upol.cz Inovace bakalářského studijního oboru Aplikovaná chemie http://aplchem.upol.cz Z.1.07/2.2.00/15.0247 Tento projekt je spolufinancován Evropským sociálním fondem a státním rozpočtem České republiky. Funkční

Více

Tovek Tools. Tovek Tools jsou standardně dodávány ve dvou variantách: Tovek Tools Search Pack Tovek Tools Analyst Pack. Připojené informační zdroje

Tovek Tools. Tovek Tools jsou standardně dodávány ve dvou variantách: Tovek Tools Search Pack Tovek Tools Analyst Pack. Připojené informační zdroje jsou souborem klientských desktopových aplikací určených k indexování dat, vyhledávání informací, tvorbě různých typů analýz a vytváření přehledů a rešerší. Jsou vhodné pro práci s velkým objemem textových

Více

METODY VÍCENÁSOBNÉHO ZAROVNÁVÁNÍ NUKLEOTIDOVÝCH SEKVENCÍ

METODY VÍCENÁSOBNÉHO ZAROVNÁVÁNÍ NUKLEOTIDOVÝCH SEKVENCÍ VYSOKÉ UČENÍ TECHNICKÉ V BRNĚ BRNO UNIVERSITY OF TECHNOLOGY FAKULTA ELEKTROTECHNIKY A KOMUNIKAČNÍCH TECHNOLOGIÍ ÚSTAV BIOMEDICÍNSKÉHO INŽENÝRSTVÍ FACULTY OF ELECTRICAL ENGINEERING AND COMMUNICATION DEPARTMENT

Více

Aminokyseliny, proteiny, enzymy Základy lékařské chemie a biochemie 2014/2015 Ing. Jarmila Krotká Metabolismus základní projev života látková přeměna souhrn veškerých dějů, které probíhají uvnitř organismu

Více

Molekulární základ dědičnosti

Molekulární základ dědičnosti Molekulární základ dědičnosti Dědičná informace je zakódována v deoxyribonukleové kyselině, která je uložena v jádře buňky v chromozómech. Zlomovým objevem pro další rozvoj molekulární genetiky bylo odhalení

Více

PCR IN DETECTION OF FUNGAL CONTAMINATIONS IN POWDERED PEPPER

PCR IN DETECTION OF FUNGAL CONTAMINATIONS IN POWDERED PEPPER PCR IN DETECTION OF FUNGAL CONTAMINATIONS IN POWDERED PEPPER Trojan V., Hanáček P., Havel L. Department of Plant Biology, Faculty of Agronomy, Mendel University of Agriculture and Forestry in Brno, Zemedelska

Více

MATEMATICKÁ BIOLOGIE

MATEMATICKÁ BIOLOGIE INSTITUT BIOSTATISTIKY A ANALÝZ Lékařská a Přírodovědecká fakulta, Masarykova univerzita MATEMATICKÁ BIOLOGIE Přírodovědecká fakulta Masarykova univerzita, Brno Studijní obor Matematická biologie Masarykova

Více

Úvodem Dříve les než stromy 3 Operace s maticemi

Úvodem Dříve les než stromy 3 Operace s maticemi Obsah 1 Úvodem 13 2 Dříve les než stromy 17 2.1 Nejednoznačnost terminologie 17 2.2 Volba metody analýzy dat 23 2.3 Přehled vybraných vícerozměrných metod 25 2.3.1 Metoda hlavních komponent 26 2.3.2 Faktorová

Více

CFD výpočtový model bazénu pro skladování použitého paliva na JE Temelín a jeho validace

CFD výpočtový model bazénu pro skladování použitého paliva na JE Temelín a jeho validace CFD výpočtový model bazénu pro skladování použitého paliva na JE Temelín a jeho validace Ondřej Burian Pavel Zácha Václav Železný ČVUT v Praze, Fakulta strojní, Ústav energetiky NUSIM 2013 Co je to CFD?

Více

PRODUKTY. Tovek Tools

PRODUKTY. Tovek Tools Analyst Pack je desktopovou aplikací určenou k vyhledávání informací, tvorbě různých typů analýz a vytváření přehledů a rešerší. Jsou vhodné pro práci i s velkým objemem textových dat z různorodých informačních

Více

Struktura nukleových kyselin Vlastnosti genetického materiálu

Struktura nukleových kyselin Vlastnosti genetického materiálu Struktura nukleových kyselin Vlastnosti genetického materiálu V předcházejících kapitolách bylo konstatováno, že geny jsou uloženy na chromozomech a kontrolují fenotypové vlastnosti a že chromozomy se

Více

Základy biostatistiky II. Veřejné zdravotnictví 3.LF UK - II

Základy biostatistiky II. Veřejné zdravotnictví 3.LF UK - II Základy biostatistiky II Veřejné zdravotnictví 3.LF UK - II Teoretické rozložení-matematické modely rozložení Naměřená data Výběrové rozložení Teoretické rozložení 1 e 2 x 2 Teoretické rozložení-matematické

Více

7. Rozdělení pravděpodobnosti ve statistice

7. Rozdělení pravděpodobnosti ve statistice 7. Rozdělení pravděpodobnosti ve statistice Statistika nuda je, má však cenné údaje, neklesejte na mysli, ona nám to vyčíslí Jednou z úloh statistiky je odhad (výpočet) hodnot statistického znaku x i,

Více

Testování statistických hypotéz

Testování statistických hypotéz Testování statistických hypotéz Na základě náhodného výběru, který je reprezentativním vzorkem základního souboru (který přesně neznáme, k němuž se ale daná statistická hypotéza váže), potřebujeme ověřit,

Více

Inferenční statistika - úvod. z-skóry normální rozdělení pravděpodobnost rozdělení výběrových průměrů

Inferenční statistika - úvod. z-skóry normální rozdělení pravděpodobnost rozdělení výběrových průměrů Inferenční statistika - úvod z-skóry normální rozdělení pravděpodobnost rozdělení výběrových průměrů Pravděpodobnost postupy induktivní statistiky vycházejí z teorie pravděpodobnosti pravděpodobnost, že

Více

Bibliografické databáze umění vyhledávat v záplavě pramenů relevantní informace

Bibliografické databáze umění vyhledávat v záplavě pramenů relevantní informace Bibliografické databáze umění vyhledávat v záplavě pramenů relevantní informace Jitka Stejskalová Ústav vědeckých informací 1. LF UK Jak si obstarám informace? informační exploze mnoho informací a jak

Více

Obecná struktura a-aminokyselin

Obecná struktura a-aminokyselin AMINOKYSELINY Obsah Obecná struktura Názvosloví, třídění a charakterizace Nestandardní aminokyseliny Reaktivita - peptidová vazba Biogenní aminy Funkce aminokyselin Acidobazické vlastnosti Optická aktivita

Více

VÝUKA studentů celkem 3 000 (bakaláři + magistři + doktorandi); 72 profesorů, 120 docentů

VÝUKA studentů celkem 3 000 (bakaláři + magistři + doktorandi); 72 profesorů, 120 docentů založena roku 1920 centrum výuky a výzkumu rozpočet v roce 2013 cca 1,114 miliardy Kč (zhruba 1:1 státní dotace a grantové prostředky) - z toho biologie má asi 1/3 (i v dalších parametrech) VÝUKA studentů

Více

Standardní algoritmy vyhledávací.

Standardní algoritmy vyhledávací. Standardní algoritmy vyhledávací. Vyhledávací algoritmy v C++ nám umožňují vyhledávat prvky v datových kontejnerech podle různých kritérií. Také se podíváme na vyhledávání metodou půlením intervalu (binární

Více

Centrum aplikované genomiky, Ústav dědičných metabolických poruch, 1.LFUK

Centrum aplikované genomiky, Ústav dědičných metabolických poruch, 1.LFUK ové technologie v analýze D A, R A a proteinů Stanislav Kmoch Centrum aplikované genomiky, Ústav dědičných metabolických poruch, 1.LFUK Motto : "The optimal health results from ensuring that the right

Více

Pravděpodobnost, náhoda, kostky

Pravděpodobnost, náhoda, kostky Pravděpodobnost, náhoda, kostky Radek Pelánek IV122, jaro 2015 Výhled pravděpodobnost náhodná čísla lineární regrese detekce shluků Dnes lehce nesourodá směs úloh souvisejících s pravděpodobností krátké

Více

Vyhledávání. doc. Mgr. Jiří Dvorský, Ph.D. Katedra informatiky Fakulta elektrotechniky a informatiky VŠB TU Ostrava. Prezentace ke dni 12.

Vyhledávání. doc. Mgr. Jiří Dvorský, Ph.D. Katedra informatiky Fakulta elektrotechniky a informatiky VŠB TU Ostrava. Prezentace ke dni 12. Vyhledávání doc. Mgr. Jiří Dvorský, Ph.D. Katedra informatiky Fakulta elektrotechniky a informatiky VŠB TU Ostrava Prezentace ke dni 12. září 2016 Jiří Dvorský (VŠB TUO) Vyhledávání 201 / 344 Osnova přednášky

Více

Automatická detekce anomálií při geofyzikálním průzkumu. Lenka Kosková Třísková NTI TUL Doktorandský seminář, 8. 6. 2011

Automatická detekce anomálií při geofyzikálním průzkumu. Lenka Kosková Třísková NTI TUL Doktorandský seminář, 8. 6. 2011 Automatická detekce anomálií při geofyzikálním průzkumu Lenka Kosková Třísková NTI TUL Doktorandský seminář, 8. 6. 2011 Cíle doktorandské práce Seminář 10. 11. 2010 Najít, implementovat, ověřit a do praxe

Více

Zpracování dat v AVG backendech. Antonín Karásek Jarek Jarcec Čecho

Zpracování dat v AVG backendech. Antonín Karásek Jarek Jarcec Čecho Zpracování dat v AVG backendech Antonín Karásek Jarek Jarcec Čecho Backend systémy Co je od nás vyžadováno zpracování uživatelských dat vytváření reportů

Více

Selekce v populaci a její důsledky

Selekce v populaci a její důsledky Genetika a šlechtění lesních dřevin Selekce v populaci a její důsledky Doc. Ing. RNDr. Eva Palátová, PhD. Ústav zakládání a pěstění lesů LDF MENDELU Brno Tento projekt je spolufinancován Evropským sociálním

Více

Počítačová chemie. výpočetně náročné simulace chemických a biomolekulárních systémů. Zora Střelcová

Počítačová chemie. výpočetně náročné simulace chemických a biomolekulárních systémů. Zora Střelcová Počítačová chemie výpočetně náročné simulace chemických a biomolekulárních systémů Zora Střelcová Národní centrum pro výzkum biomolekul, Masarykova univerzita, Kotlářská 2, 611 37 Brno, Česká Republika

Více

Moderní systémy pro získávání znalostí z informací a dat

Moderní systémy pro získávání znalostí z informací a dat Moderní systémy pro získávání znalostí z informací a dat Jan Žižka IBA Institut biostatistiky a analýz PřF & LF, Masarykova universita Kamenice 126/3, 625 00 Brno Email: zizka@iba.muni.cz Bioinformatika:

Více

Interakce viru klíšťové encefalitidy s hostitelským organismem a patogeneze infekce

Interakce viru klíšťové encefalitidy s hostitelským organismem a patogeneze infekce Parazitologický ústav, Akademie věd České republiky Laboratoř interakcí vektor-hostitel České Budějovice Interakce viru klíšťové encefalitidy s hostitelským organismem a patogeneze infekce Daniel Růžek,

Více

Genetická diverzita masného skotu v ČR

Genetická diverzita masného skotu v ČR Genetická diverzita masného skotu v ČR Mgr. Jan Říha Výzkumný ústav pro chov skotu, s.r.o. Ing. Irena Vrtková 26. listopadu 2009 Genetická diverzita skotu pojem diverzity Genom skotu 30 chromozomu, genetická

Více

Enzymové pexeso. L: lactose P: operon

Enzymové pexeso.  L: lactose P: operon Enzymové pexeso http://web.vscht.cz/~spiwokv/enzymologie/pexeso/ L: lactose P: operon Struktura proteinů: Primární: Struktura proteinů: Primární: Sekvenování: - sekvenováním (c)dna - hmotnostní spektrometrií

Více

REGIONÁLNÍ KONCENTRACE AKTIVIT PODNIKŮ. Příklad využití individuálních dat ve spojení s autokorelační statistikou

REGIONÁLNÍ KONCENTRACE AKTIVIT PODNIKŮ. Příklad využití individuálních dat ve spojení s autokorelační statistikou REGIONÁLNÍ KONCENTRACE AKTIVIT PODNIKŮ Příklad využití individuálních dat ve spojení s autokorelační statistikou Kristýna Meislová [meislova@tc.cz] 14. dubna 2016 Co bude následovat I. Proč zkoumat prostorovou

Více

Simulované žíhání jako nástroj k hledání optimálního řešení

Simulované žíhání jako nástroj k hledání optimálního řešení Simulované žíhání jako nástroj k hledání optimálního řešení Michael Pokorný - Střední škola aplikované kybernetiky s.r.o. - pokorny.michael@ssakhk.cz 21. června 211 Úvod Nedeterministická metoda optimalizace

Více

Genotypy absolutní frekvence relativní frekvence

Genotypy absolutní frekvence relativní frekvence Genetika populací vychází z: Genetická data populace mohou být vyjádřena jako rekvence (četnosti) alel a genotypů. Každý gen má nejméně dvě alely (diploidní organizmy). Součet všech rekvencí alel v populaci

Více

PREDIKCE VLIVU AMINOKYSELINOVÝCH MUTACÍ NA SEKUNDÁRNÍ STRUKTURU PROTEINŮ

PREDIKCE VLIVU AMINOKYSELINOVÝCH MUTACÍ NA SEKUNDÁRNÍ STRUKTURU PROTEINŮ VYSOKÉ UČENÍ TECHNICKÉ V BRNĚ BRNO UNIVERSITY OF TECHNOLOGY FAKULTA INFORMAČNÍCH TECHNOLOGIÍ ÚSTAV INFORMAČNÍCH SYSTÉMŮ FACULTY OF INFORMATION TECHNOLOGY DEPARTMENT OF INFORMATION SYSTEMS PREDIKCE VLIVU

Více

Experimentální systém pro WEB IR

Experimentální systém pro WEB IR Experimentální systém pro WEB IR Jiří Vraný Školitel: Doc. RNDr. Pavel Satrapa PhD. Problematika disertační práce velmi stručný úvod WEB IR information retrieval from WWW, vyhledávání na webu Vzhledem

Více

Zajišťování shody v činnosti facility management. Jan Dressler,

Zajišťování shody v činnosti facility management. Jan Dressler, Zajišťování shody v činnosti facility management Jan Dressler, 22.5.2012 Rizika správce a jejich zvládnutí Správce objektu přejímá rizika vlastníků, uživatelů a třetích stran souvisejících s objektem v

Více